KEGG   Kineococcus radiotolerans: Krad_3970Help
Entry
Krad_3970         CDS       T00562                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
kra  Kineococcus radiotolerans
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:kra00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Krad_3970
Enzymes [BR:kra01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Krad_3970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2917724..2919760)
Genome map
AA seq 678 aa AA seqDB search
MQRWSDGAAGLVFGSDYNPEQWPAEVRADDVRLMQRAGVNLVSVGIFSWGLLEPRPGRFD
FGWFDAVLDDLHAGGIGVSLATATASPPAWLGELHPEVLPVDADGHRVVFGSRQSWCPSS
PVYRERSLALVEALAERYGQHPALRLWHVSNELGCHNARCYCDVSAAAFRTWLADRYPDV
AALNDAWATAFWSQHYTSFEQVQVPARTSSFHNPAQALDFARFSSDELLGQHLAEKDVLR
RVTPEVPVTTNFMIGSQLNPMDYGRWAREQDVVANDHYLIHGNYDDPRAELAYSADLTRG
TASGQPWLLMEHSTSAVNWQPVNVAKPAGEMLQDSLSHVARGADGICFFQWRASAGGAEQ
WHSALVPHAGEDTERFREVTELGALLGRLGELRGSTTSNDVAILVDWQNAWAMESETLPS
RRVGHADLALRVHGLLREARTGADVVPVGAHPHDLAEVLAGYRVLVVPTLYLCDDTTAAA
VTAAAESGTHVLVTYFSGIVDETARVRLGGYPGAFRDLLGIRVEEFHPLPDGVAGELDDA
TVGDVWSEIATADDDVEVLSRYAEGATAGCPALTRRDLPSGARAWYLGTSLDDEALAGLL
HAVCTTAGVAPVAEASGPVDVVRRRAADGRSWLFALNHGEEPATVTVRGFDLVAEVDVDG
LDLEPGASAVVRELGPGD
NT seq 2037 nt NT seq  +upstreamnt  +downstreamnt
gtgcagcgatggagcgacggagcggcgggactcgtcttcgggtccgactacaaccccgag
cagtggccggccgaggtgcgggccgacgacgtgcggctgatgcagcgggcgggggtcaac
ctcgtctccgtgggcatcttctcctggggcctgctcgaaccgcgacccggccgcttcgac
ttcggctggttcgacgccgtcctcgacgacctgcacgccggcggcatcggggtctcgctg
gccaccgcgaccgcctcccccccggcctggctcggcgagctccaccccgaggtgctcccc
gtcgacgccgacggccaccgggtcgtcttcggcagccggcagagctggtgccccagctcg
ccggtctaccgcgaacgctccctcgccctcgtcgaggccctcgccgagcgctacgggcag
caccccgcgctgcggctgtggcacgtcagcaacgagctgggctgccacaacgcccgctgc
tactgcgacgtcagcgccgcggccttccgcacctggctggccgaccggtaccccgacgtc
gccgcgctgaacgacgcgtgggccacggccttctggagccagcactacacctccttcgag
caggtgcaggtgcccgcgcgcacctcctccttccacaaccccgcccaggccctggacttc
gcgcggttctcctccgacgagctcctcgggcagcacctggccgagaaggacgtcctgcgc
cgggtcacccccgaggtcccggtcacgacgaacttcatgatcggctcgcagctgaacccg
atggactacggccgctgggcccgcgagcaggacgtcgtcgccaacgaccactacctgatc
cacgggaactacgacgacccccgcgccgagctcgcctactccgccgacctgacccggggg
acggcctcggggcagccgtggctgctcatggagcactccacctcggcggtgaactggcag
ccggtcaacgtcgccaagcccgccggggagatgctgcaggacagcctctcccacgtcgcc
cgcggcgccgacgggatctgcttcttccagtggcgggcctccgccggcggcgccgagcag
tggcactccgcgctcgtcccgcacgccggggaggacaccgagcgcttccgcgaggtcacc
gagctcggcgccctgctcggccggctgggggagctgcgcggctccaccacgagcaacgac
gtggcgatcctcgtcgactggcagaacgcctgggcgatggagtcggagaccctgccctcc
cggcgcgtcgggcacgccgacctcgccctgcgcgtccacggcctgctgcgcgaggcccgc
accggcgccgacgtcgtccccgtgggcgcccacccgcacgacctcgccgaggtcctcgcc
ggctaccgcgtcctcgtcgtccccaccctctacctgtgcgacgacaccaccgccgccgcc
gtcaccgccgccgccgagtccggcacccacgtcctcgtcacgtacttctccggcatcgtc
gacgagaccgcccgggtgcgcctcggcggctaccccggcgcgttccgcgacctgctcggg
atccgcgtcgaggagttccacccgctgcccgacggggtcgccggcgagctcgacgacgcc
accgtgggcgacgtgtggtccgagatcgccaccgccgacgacgacgtcgaggtcctctcc
cgctacgccgagggtgccaccgccgggtgccccgccctgacccggcgcgacctgccctcc
ggggcgcgggcctggtacctgggcacctccctggacgacgaggccctcgccgggctgctg
cacgccgtctgcaccaccgccggggtcgcccccgtcgccgaggccagcggcccggtcgac
gtcgtccgccgtcgcgccgcggacgggcgcagctggctgttcgccctcaaccacggcgag
gaacccgcgaccgtgaccgtccggggcttcgacctcgtggccgaggtcgacgtcgacggc
ctcgacctcgaacccggggccagcgcggtcgtgcgcgagctcggacccggcgactga

DBGET integrated database retrieval system