KEGG   Kineococcus radiotolerans: Krad_4274Help
Entry
Krad_4274         CDS       T00562                                 

Definition
diphosphate--fructose-6-phosphate 1-phosphotransferase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
kra  Kineococcus radiotolerans
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:kra00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Krad_4274
   01230 Biosynthesis of amino acids
    Krad_4274
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Krad_4274
   00030 Pentose phosphate pathway
    Krad_4274
   00051 Fructose and mannose metabolism
    Krad_4274
   00052 Galactose metabolism
    Krad_4274
  Energy metabolism
   00680 Methane metabolism
    Krad_4274
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Krad_4274
Enzymes [BR:kra01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Krad_4274
Protein phosphatases and associated proteins [BR:kra01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Krad_4274
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2606322..2607707
Genome map
AA seq 461 aa AA seqDB search
MVEPTERPASREPIDFTVESLGPRTVDSPLAPRLLARRTTHHYIEETDRVLFDDTLSKVS
RRDGDLEDLPSLEPTGPRKKIFFDPSKTRVGIVTCGGLCPGINNVIRGLVSELTNHYGVR
RIYGFKNGYQGFIPSYGHDVVDLTPESVSDIDGEGGTILGTSRGQQDAVEVVDCLERMGI
SILFVIGGDGTMRGAQKISAEIKARDLKIAVVGIPKTIDNDIPFIDQSFGFQSAFSEATR
SIRSAKVEARTAPNGVSIVKLMGRHSGFIACYAALAQNDADFVLIPEVPFTLAGPGGFLE
KLREKVASQGHALVVAAEGAGQELFDDDGLKDASGNKKLQDVGRLLRQAITDDFAAHDLE
LNMRYIDPSYVIRSVPANPYDSVYCIRLAHAAVHAAMAGRTNMVVGRWRRRFVHIPIALA
VSARNQVDPHGDLWWSVLEATGQPWSFGDFAPEHVSAFGGQ
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atggtcgagcccaccgaacgccccgcgagccgcgagccgatcgacttcaccgtcgagtcg
ctcgggccgcgcacggtcgactccccgctcgccccccggttgctggcgcgccgcacgacg
caccactacatcgaggagaccgaccgggtcctgttcgacgacaccctctccaaggtctcc
cgccgcgacggcgacctcgaggacctgcccagcctcgaacccaccggccctcgcaagaag
atcttcttcgacccctccaagacccgggtcgggatcgtcacctgcggcgggctgtgcccg
ggcatcaacaacgtcatccgcgggctggtctcggagctgaccaaccactacggcgtccgc
cgcatctacgggttcaagaacggctaccagggcttcatccccagctacggccacgacgtc
gtcgacctcaccccggagtccgtcagcgacatcgacggcgaggggggcaccatcctcggg
acctcgcgcggccagcaggacgccgtggaggtcgtcgactgcctcgagcgcatgggcatc
tcgatcctcttcgtcatcggcggcgacggcaccatgcgcggagcgcagaagatctccgcc
gagatcaaggcccgcgacctgaagatcgccgtcgtcggcatccccaagacgatcgacaac
gacatccccttcatcgaccagagcttcgggttccagtccgcgttcagcgaggccacccgc
tccatccgctcggccaaggtcgaggcccgcaccgcccccaacggcgtcagcatcgtcaag
ctcatgggccgccactccggcttcatcgcctgctacgccgcgctcgcccagaacgacgcc
gacttcgtgctcatccccgaggtgccgttcaccctcgccggcccggggggcttcctggag
aagctgcgcgagaaggtcgcctcgcagggccacgccctcgtcgtcgccgccgagggggcc
gggcaggagctcttcgacgacgacgggctcaaggacgcctccggcaacaagaagctgcag
gacgtggggcgcctgctgcgccaggccatcaccgacgacttcgccgcgcacgacctcgag
ctcaacatgcgctacatcgaccccagctacgtcatccgcagcgtcccggcgaacccctac
gacagcgtctactgcatccggctcgcgcacgcggccgtgcacgcggcgatggccgggcgc
accaacatggtcgtgggccggtggcggcggcggttcgtgcacatcccgatcgcgctcgcg
gtgtccgcccgcaaccaggtcgacccccacggggacctgtggtggtcggtgctggaggcg
acggggcagccgtggtcgttcggggacttcgccccggaacacgtcagcgcgttcggcggg
cagtga

DBGET integrated database retrieval system