KEGG   Kineococcus radiotolerans: Krad_4286Help
Entry
Krad_4286         CDS       T00562                                 

Definition
(GenBank) catalytic domain of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
kra  Kineococcus radiotolerans
Pathway
kra00010  Glycolysis / Gluconeogenesis
kra00020  Citrate cycle (TCA cycle)
kra00620  Pyruvate metabolism
kra01100  Metabolic pathways
kra01110  Biosynthesis of secondary metabolites
kra01120  Microbial metabolism in diverse environments
kra01130  Biosynthesis of antibiotics
kra01200  Carbon metabolism
Module
kra_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:kra00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Krad_4286
   00020 Citrate cycle (TCA cycle)
    Krad_4286
   00620 Pyruvate metabolism
    Krad_4286
Enzymes [BR:kra01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Krad_4286
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 HlyD_D23
Motif
Other DBs
NCBI-ProteinID: ABS05749
JGI: Krad4286
UniProt: A6WG10
Position
2592706..2594058
Genome map
AA seq 450 aa AA seqDB search
MNQRFALPDVGEGLTEAEIVTWKVKPGDTVALNDVLLEIETAKSLVELPSPYAGVVAELL
VAEGDTVEVGTDIVVVDDGSGAAAGPADPEPAAEPASEPAEPADEPAEPAAVAEASPQPA
PDGGSGATLVGYGSREVAPRRRGARTTREPAPAPGPAPGAPAAHVLAKPPVRKLARDLGV
DLARAVPTGPGGTVTRADVLALVPAAPAEPPRRVEQHARERHVPIRGIRKATAAAMVESA
FSAPHVTVFTTVDATRTMKLVQRLKTDPEFAGIKVSPLLLVAKALLVAVRRNPDINATWD
EENQVIVVKNYVNLGIAVATPRGLLVPNVKDADEMTLKDLAVHLNSVAGTAREGRAAPRD
LAGGTITISNVGTFGIDTGTPILNPGEAAILAVGKIAQRPWVHKGKIKPRYLATLGLSFD
HRMLDGESGSRALADVAAVLEDPARALTWS
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
ttgaaccagcggttcgccctgcccgacgtcggtgaaggactcaccgaggccgagatcgtc
acctggaaggtcaagcccggggacaccgtcgccctcaacgacgtcctcctggagatcgag
accgccaagtccctggtcgagctgcccagcccctacgccggggtcgtcgcggaactcctc
gtcgccgagggggacaccgtcgaggtcgggaccgacatcgtcgtcgtcgacgacggctcg
ggcgccgccgcgggacccgcggaccccgagcccgccgccgagcccgcctccgaacccgcc
gaaccggccgacgaacccgctgagcccgcggccgtcgccgaggcgagcccgcagccggcc
ccggacggggggtcgggggcgacgctggtcggctacggctcccgcgaggtcgccccccgc
cgccgcggggcccgcacgacccgcgaacccgcccccgcgcccggacccgcccccggggcg
ccggccgcgcacgtcctggccaaaccccccgtccgcaagctggcccgcgacctcggggtg
gacctcgcccgggccgtgcccaccggccccggcggcacggtgacccgcgccgacgtcctc
gccctggtgcccgccgccccggccgaacccccgcgccgcgtcgagcagcacgcccgcgag
cggcacgtccccatccgcggcatccgcaaggcgaccgcggccgcgatggtcgagagcgcc
ttctccgccccgcacgtcacggtgttcaccaccgtcgacgccacccgcaccatgaagctc
gtgcagcggctcaagaccgatcccgagttcgccgggatcaaggtctccccgctgctgctg
gtggcgaaggcgctgctcgtcgcggtgcggcgcaaccccgacatcaacgcgacctgggac
gaggagaaccaggtcatcgtcgtgaagaactacgtcaacctcgggatcgcggtcgcgacc
ccgcgcgggctgctcgtcccgaacgtcaaggacgccgacgagatgacgctgaaggacctc
gcggtccacctgaactccgtcgccggcaccgcgcgcgagggccgggccgcgccgcgcgac
ctcgccggggggaccatcaccatcagcaacgtcgggacgttcggcatcgataccgggacc
ccgatcctcaacccgggcgaggcggcgatcctcgccgtggggaagatcgcgcagcggccg
tgggtgcacaagggcaagatcaagccccgctacctggcgaccctgggcctctccttcgac
caccgcatgctggacggcgagagcggttcgcgggcgctggccgacgttgccgccgtcctg
gaggacccggcgcgcgccctcacctggagctga

DBGET integrated database retrieval system