KEGG   Kocuria rhizophila: KRH_01410Help
Entry
KRH_01410         CDS       T00701                                 

Gene name
fdhA
Definition
glutathione-independent formaldehyde dehydrogenase (EC:1.2.1.46)
Orthology
K00148  
glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
krh  Kocuria rhizophila
Pathway
Chloroalkane and chloroalkene degradation
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:krh01200]
Metabolism; Energy metabolism; Methane metabolism [PATH:krh00680]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:krh00625]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
149585..150778
Genome map
AA seq 397 aa AA seqDB search
MADGNRAVVFHGTGNMQVDTVEYPKLVMPNGKKAPHGVILRIVATNICGSDLHIYRGSFP
VPEGMRMGHEMTGEVVEVGSDVEFLSEGDLVSVPFNVACGRCRNCRAGRTEVCETTNPDT
ACAAYGFNLGNWDGGQSEYMFVPYADFQLLRFPDRDQAMEKIRDLALLSDILPTAFHGLM
EAGAKPGSTVYIAGAGPVGRCGAAAARLLGASCIIVGDYSKERLDLVRQNGCETIDLSED
VPLTEQIEAILGEPMVDCAVDYVGTEAHGIGSEAENMDPAYAVNQVLDATRAGGATGIIG
VYGPDPLASSKAEQEGTYPIDFGKAWIKSPRISAGQAPIMHYNRQLMMSILWDRMPYLSK
MLNTKVISLDEVPEAYAAFDAGSDDKLIIDPHGMIKA
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggcagacggcaatcgcgcagtagtgttccacggcaccggcaacatgcaggtggacacg
gtggagtacccaaagctcgtcatgccgaacgggaagaaggccccgcacggcgtcatcctc
aggatcgtggccacgaacatttgcggtagcgacctgcacatctaccgcggctcgttcccc
gtgcctgagggcatgcgcatgggccacgagatgaccggggaggtcgtggaagtaggctcg
gacgtcgagttcttgagcgagggagacctcgtctccgtgccgttcaacgtggcgtgcggc
cgttgccgtaactgtcgtgccggacgcaccgaagtgtgcgagaccaccaacccggacacc
gcgtgcgccgcgtacgggttcaacctgggcaactgggacggcggacagtctgagtacatg
ttcgtgccgtacgcggacttccagctgctgcgcttcccggaccgggaccaggccatggag
aagatccgggacctcgctctgctctccgacatcctgcccaccgcattccacggcctcatg
gaggcgggcgccaagcccggttctacggtctacatcgcgggcgccgggcccgtgggccgt
tgcggggccgccgcggcacggctgctcggggcgtcctgcatcattgtgggcgactacagc
aaggagcggctggatctcgtgcggcagaacggctgcgagaccatcgacctctccgaagac
gtcccgctgaccgagcagatcgaggcgatcctgggcgagcccatggtcgactgcgcggtg
gactacgtgggcaccgaggcccacggcatcggctccgaggcggagaacatggatcccgcg
tacgccgtgaaccaggtcctggacgccacccgcgcgggcggtgccacgggtatcatcggc
gtctacggcccggatccgctggcatcctcgaaggcggagcaggagggtacgtaccccatc
gacttcggcaaggcatggatcaagtccccgcgcatctctgctggccaggcgcccatcatg
cactacaatcgtcagctcatgatgtcgatcctctgggaccgcatgccgtacctgagcaag
atgctcaacaccaaggtcatcagcctcgacgaggtgcctgaggcctacgcggccttcgat
gccggctcggatgacaagctcatcatcgacccgcacggcatgatcaaggcctga

DBGET integrated database retrieval system