KEGG   Kocuria rhizophila: KRH_01700Help
Entry
KRH_01700         CDS       T00701                                 

Gene name
echA
Definition
enoyl-CoA hydratase (EC:4.2.1.17)
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
krh  Kocuria rhizophila
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:krh00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    KRH_01700 (echA)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    KRH_01700 (echA)
   00650 Butanoate metabolism
    KRH_01700 (echA)
  Lipid metabolism
   00071 Fatty acid degradation
    KRH_01700 (echA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    KRH_01700 (echA)
   00310 Lysine degradation
    KRH_01700 (echA)
   00360 Phenylalanine metabolism
    KRH_01700 (echA)
   00380 Tryptophan metabolism
    KRH_01700 (echA)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    KRH_01700 (echA)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    KRH_01700 (echA)
   00281 Geraniol degradation
    KRH_01700 (echA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    KRH_01700 (echA)
   00627 Aminobenzoate degradation
    KRH_01700 (echA)
   00930 Caprolactam degradation
    KRH_01700 (echA)
Enzymes [BR:krh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     KRH_01700 (echA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
188804..189586
Genome map
AA seq 260 aa AA seqDB search
MTENTYDTILVRREGRVGVITLNRPKALNALNVQTMTELVAAATDLDRDPEIGAIVLTGS
EKAFAAGADIKEMGSKTGSDMYREDFFSAWDTFARLRTPKIAAVSGYALGGGCEAAMMCD
MIIAADTAKFGQPEITLGVIPGMGGTQRLTRAVGKAKAMDLILTGRQMDAEEAERSGLVS
RVVPADSLMDTALEVAAKIGSMSKPVAQHAVETVNTAYETTLAAGLQYERRVFHGLFSTA
DQKEGMAAFTEKRKPNFSHE
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgactgagaacacctacgacaccatcctggtccgccgcgagggacgcgtgggcgtgatc
acgctgaaccgccccaaggcgctgaacgcgctgaacgtgcagaccatgaccgagctcgtg
gcggccgccaccgacctggaccgcgatccggagatcggcgcgatcgtcctgaccggctcc
gagaaggcgttcgccgcgggcgccgacatcaaggagatgggctccaagaccggttcggac
atgtaccgcgaggacttcttctccgcgtgggacaccttcgcccggctgcgcactccgaag
attgccgcggtctcgggctacgccctgggcggtggctgcgaggcggccatgatgtgcgac
atgatcatcgccgcggacaccgccaagttcgggcagccggagatcaccctgggcgtcatc
ccgggcatgggcggcacgcagcggctcacccgtgcggtgggcaaggccaaggcgatggac
ctcatcctcaccggccgccagatggacgccgaggaggccgagcgctccggactcgtctcc
cgcgtggttcccgccgactccctcatggacaccgcgctggaggtcgccgcgaagatcggt
tccatgtccaagccggtggcccagcacgccgtggagacggtgaacaccgcgtacgagacc
accctggccgccggcctgcagtacgagcgccgcgtgttccacgggctgttctccactgcg
gaccagaaggagggcatggcggccttcacggagaagcggaagccgaacttctcccacgag
tga

DBGET integrated database retrieval system