KEGG   Kocuria rhizophila: KRH_02330Help
Entry
KRH_02330         CDS       T00701                                 

Gene name
bdh
Definition
3-hydroxybutyrate dehydrogenase (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
krh  Kocuria rhizophila
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:krh00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:krh00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
258547..259299
Genome map
AA seq 250 aa AA seqDB search
MTEQSLQEKKALVTGGASGIGAAAVRALAARGAHVVVADIDHDAAARLADEVGGEAWAVD
LTDTAALARLRLDVDVLVNNAGIQKVSPLQDVEPADLHRILTLMLESPFLLIRAALPHMY
EQGWGRIVNVSSVHGLRASPYKAAYVAAKHGLEGLSKAVALEGAPHGVTSNCVNPSYVRT
PLVDKQIKDQAATHGIPEEQVVEKIMLTESAIKRLVEPEEVAELIAFLAGPSAGMVTGSS
YAMDGGWTAS
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaacagtctctgcaggagaagaaggcactcgtcaccggaggtgccagcggcatc
ggtgcggcggccgtccgggcgctcgccgcgcgcggtgcgcacgtggtggtcgcggacatc
gaccacgacgccgccgcgcgtctcgcggacgaggtgggcggtgaagcctgggctgtggac
ctcacggacaccgccgcgctggcgcggctgcgcctggacgtggacgtgctggtcaacaac
gcgggcatccagaaggtctcgcccctccaggacgtggagcccgcggacctgcacaggatc
ctcacgctcatgctggagtccccgttcctgctgatccgcgcggccctgccgcacatgtac
gagcagggctggggccggatcgtcaacgtgtcctcggtgcacgggctgcgggcctcgccg
tacaaggccgcgtacgtggccgccaagcacggcctggaggggctgtccaaggcggtggcc
ctggagggcgcgccgcacggcgtcacgagcaactgcgtgaaccccagctacgtgcgcacc
ccgctggtggacaagcagatcaaggaccaggcggccacgcacggcatcccggaggagcag
gtggtcgagaagatcatgctcaccgagtcggccatcaagcgcctcgtggagcccgaggag
gtcgcggagctgatcgcgttcctcgcgggcccgtccgccgggatggtcacgggctcctcc
tacgccatggacggcggctggaccgcctcctga

DBGET integrated database retrieval system