KEGG   Kocuria rhizophila: KRH_02680Help
Entry
KRH_02680         CDS       T00701                                 

Definition
putative zinc-containing alcohol dehydrogenase (EC:1.1.1.-)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
krh  Kocuria rhizophila
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:krh00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    KRH_02680
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KRH_02680
  Lipid metabolism
   00071 Fatty acid degradation
    KRH_02680
  Amino acid metabolism
   00350 Tyrosine metabolism
    KRH_02680
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    KRH_02680
   00626 Naphthalene degradation
    KRH_02680
Enzymes [BR:krh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     KRH_02680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
297582..298646
Genome map
AA seq 354 aa AA seqDB search
MKVFGHAEPGAPAEEMDIERPALEGTDVLVRVTNSGVCHSDVHCQDGYFDLGDAGRHELT
AAGAQYPVVLGHEIVGEVVATGPDATVQPGDTKYIVYPWIGCGECQACQEDRENYCSGKK
RNLSVQLDGGYAEEVHVPGERYLIPLGDIDPSFGATLACSGLTSYSAVQKIMPVPADKPV
AVIGAGGVGLMTIAVLKALGHENIVAVDMSEAALRNATAVGASATVTVGGENLVKDIVAA
GGEKIAAAIDLVNNGDTSSAALFAMANGGTLVSVGLFGGQYSFPTALAAFNLLNIRGNFV
GSLPELKELVKLAQDVELPRPPIMEVPLSAEQVNASLDGLRNRTLNGRAVLVAD
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtcttcggtcacgcagagcccggtgccccggcggaggagatggacatcgagcgt
cccgcgctggagggcacggacgtcctggtccgggtcacgaactcgggagtgtgccactcg
gacgtccactgccaggacgggtacttcgacctcggcgacgccggacgccacgagctcacc
gccgcgggggcccagtaccccgtggtgctcggccacgagatcgtgggggaggtggtggcc
accggtccggacgccaccgtgcaacccggtgacaccaagtacatcgtctacccgtggatc
gggtgcggcgagtgccaggcgtgccaggaggaccgggagaactactgcagcgggaagaag
cgcaacctctcggtgcagctggacggcggctacgccgaggaggttcacgtcccgggagag
cgctacctgatcccgctgggcgacatcgacccgtccttcggtgccacgctcgcgtgctcc
gggctgacctcgtactccgcggtgcagaagatcatgccggttcccgcggacaagcccgtg
gccgtgatcggcgccggcggcgtgggactcatgaccatcgccgtcctcaaggccctgggc
cacgagaacatcgtggccgtggacatgagcgaggccgcgctgcgcaacgccaccgcggtg
ggcgcctccgcgaccgtcaccgtgggcggggagaacctggtcaaggacatcgtcgcggcc
ggcggggagaagatcgccgcggcaattgacctggtcaacaacggggacacctccagcgcc
gcgctgttcgccatggccaacggcggcaccctggtgagcgtggggctgttcggtggtcag
tactcgttccccaccgcgctcgcggcgttcaacctgctgaacatccgcggcaacttcgtg
ggcagcctcccggagctcaaagagctcgtgaagctcgcccaggacgtggagctgccccgg
ccgcccatcatggaggtcccgctcagcgccgagcaggtcaacgcgtccctggacggcctg
cgcaaccgcacgctcaacggccgcgcggtgctcgtggcggactga

DBGET integrated database retrieval system