KEGG   Kocuria rhizophila: KRH_02820Help
Entry
KRH_02820         CDS       T00701                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
krh  Kocuria rhizophila
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:krh03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(312673..313278)
Genome map
AA seq 201 aa AA seqDB search
MYEGPVQDLIDELGRLPGVGPKSAQRIAFHLLDADKDEVQQLVDAISTVKTSVSFCVICG
NVTEQEECAICRDARRDRSVICVVEESKDVMAIERTRSYRGLYHVLGGAISPLQGVGPDQ
LRIRELMTRLSDETVQEIVLATDPNLEGEATATYLSRLLKTLGIRVTRLASGLPVGGDLE
YADEVTLGRAFEGRTVVSEAT
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
gtgtacgaaggaccggttcaagacctcatcgacgagctggggcggttgcccggtgtgggc
cccaagtccgcgcagcgcatcgcgttccacctgctggacgcggacaaggacgaggtccag
cagctcgtggacgccatctccaccgtgaagacctccgtgtccttctgcgtgatctgcggc
aacgtgaccgagcaggaggagtgcgccatctgccgggacgcccgccgggaccgcagcgtg
atctgcgtggtggaggagtccaaggacgtcatggccatcgaacgcacccgcagctaccgc
gggctctaccacgtgctgggcggtgccatctcgccgctgcagggagtgggcccggaccag
ctgcgcattcgtgagctgatgacccgcctgtcggacgagacagtgcaggagatcgtgctg
gccacggaccccaacctcgagggcgaggccaccgccacgtacctgtcccggctgctgaag
accctcggcatccgggtcacgcggctggcctcggggctgccggtgggcggtgacctggag
tacgcggacgaggtcacgctgggccgcgcgttcgagggccgcacggtggtctccgaggcc
acgtag

DBGET integrated database retrieval system