KEGG   Kocuria rhizophila: KRH_03590Help
Entry
KRH_03590         CDS       T00701                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
krh  Kocuria rhizophila
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:krh00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    KRH_03590 (malQ)
Enzymes [BR:krh01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     KRH_03590 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
396348..398579
Genome map
AA seq 743 aa AA seqDB search
MAEQAGNSGDTTVRRLATEYGVATEYEGFDGEHESVPDATLRSVLTALGADVSDDDAVAR
SLRERESAPWRRLLPPVVVTEVGRAATVAVTTAPGDTVRVRLWPEGDQDAERALEPAADE
EPETREVDGEQRRRVPYALPAELPLGWYRLEAVTGSGERARIDVAVTPRRLSTTDRLRGR
RRWGYMAQLYSVMSSRSWGVGDLSDLASLAALSGVQGADYVLINPLHAAEPEPPVEPSPY
LPSSRRFFNPLYLRVADVAEFPYLRPADREVVDRLAAVQRKAVLDPSSIDRDPAYAAKLK
TLELLYTVRRSPYRQQQLEAFVAQAGQPLQDFALWCALREELGEDSPLWRDEARSPGSPY
AQEARTRLAHRVNFHVWLQWLLDEQLEAAQRAAHRAGMDIGVVHDLAVGVHKHGADAWAL
QDAMAAGVSVGAPADMYNQLGQDWSQPPWHPEKLAELGYRPWRQMMRTIFRHAGGVRIDH
VAGLFRLWWIPEGNTASDGTYVYYDHEAMVGVLALEAELAGVVVVGEDLGTVEDSVREYL
ESKGVLGTSILWFEMDGDVPRDPSRYRELCMASVNTHDLPPTPGYLEGVQLQLREDLGLL
ARSPEEEREDARAQLETFFAAVTEAGYLPGGADADAETKVEALYRYLCDAPSLLLNVSLV
DAVGEKRIQNQPGTSDEYPNWRVPLADADGRPVMLESLPRMPRVQRLVDVVNEALGTHRR
TSAVTAPEQPERRDLADPFRSAS
NT seq 2232 nt NT seq  +upstreamnt  +downstreamnt
atggctgagcaggcagggaattcaggggacaccacggtgcggcgcctggccaccgagtac
ggtgtggccaccgagtacgagggcttcgacggcgagcacgagagcgttccggacgccacg
ctgcgcagcgttctcaccgcgctgggggcggacgtgtccgacgacgacgccgtggcccgc
tccctgcgcgagcgcgagtccgcgccgtggcggcggctgctgccgcccgtggtggtcacc
gaggtcggcagggcggccaccgtggccgtgaccaccgccccgggggacacggtgcgcgtg
cggctgtggccggagggggaccaggacgcggagcgtgccctggagcccgccgcggacgag
gagcccgagacgcgcgaggtggacggtgagcagcggcgtcgtgtgccctacgcgctgccc
gcggagctgcccctgggctggtaccggctcgaggcggtcacgggatcgggtgagcgcgcg
aggatcgacgtggccgtgacgccgcggcggctgagcaccaccgaccggctgcgggggcgt
cggcgctgggggtacatggcgcagctctactcggtgatgtcctcgcgctcgtggggggtg
ggggacctctcggacctcgcctcgctcgcggcgctgagcggtgtgcagggcgcggactac
gtgctcatcaaccccctgcacgcggccgagcccgagccgcccgtggagccctccccgtac
ctgccctcgagccgccggttcttcaaccccctgtacctgcgcgtggcggacgtcgcggag
ttcccctacctgcgccccgcggaccgtgaggtggtggaccgcctggccgcggtgcagcgc
aaggccgtgctggacccctcctcgatcgaccgggacccggcctacgccgccaagctcaag
accctggagctgctctacaccgtgcgccgctcgccctaccgccagcagcagctggaggcg
ttcgtggcgcaggcgggccaaccgctgcaggacttcgcgctgtggtgcgcgctgcgcgag
gagttgggggaggactccccgctgtggcgggacgaggcgcgctcgcccgggtccccgtac
gcgcaggaggcccgcacccggctggcccaccgggtcaacttccacgtgtggctgcagtgg
ctgctggacgagcagctcgaggcggcgcagcgcgcggcgcaccgcgcggggatggacatc
ggcgtggtgcacgacctcgcggtgggcgtgcacaagcacggcgcggacgcctgggcgctg
caggacgccatggcggcgggcgtgagcgtgggtgcccccgcggacatgtacaaccagctg
ggccaggactggagccagcccccgtggcaccccgagaagctcgcggagctgggctaccgg
ccgtggcgccagatgatgcgcaccatcttccggcacgccggaggggtgcggatcgaccac
gtggcgggcctgttccggctctggtggatccccgagggcaacaccgcctcggacggcacg
tacgtctactacgaccacgaggccatggtgggcgtgctggcgctggaggccgagctcgcc
ggcgtggtggtggtgggcgaggacctcggcacggtcgaggacagcgtgcgcgagtacctg
gagtccaagggcgtgctgggcacctcgatcctgtggttcgagatggacggggacgtcccc
cgggacccgtcccgctaccgggagctgtgcatggcctcggtcaacacccacgacctgccg
cccacgcccgggtacctggagggcgtgcagctgcagctgcgggaggacctcgggctgctg
gcacgctcccccgaggaggagcgggaggacgcccgcgcccagctcgagacgttcttcgcg
gccgtcacggaggcggggtacctgcccggaggtgcggacgccgacgccgagacgaaggtc
gaggcgctctaccgctacctgtgcgatgcgccgtccctgctgctcaacgtgtccctcgtg
gacgccgtgggggagaagcggatccagaaccagccgggcaccagcgacgagtaccccaac
tggcgcgttccgctcgcggacgcggacggccggccggtgatgctcgagtccctgcccagg
atgccgcgcgtgcagcgcctcgtggacgtggtcaacgaggctctgggcacccaccggcgc
acctccgccgtgaccgcgcccgagcagccggagcgccgggacctcgcggacccgttccgc
agcgcgtcctga

DBGET integrated database retrieval system