KEGG   Kocuria rhizophila: KRH_04060Help
Entry
KRH_04060         CDS       T00701                                 

Definition
(GenBank) hypothetical protein
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
krh  Kocuria rhizophila
Pathway
krh00010  Glycolysis / Gluconeogenesis
krh01100  Metabolic pathways
krh01110  Biosynthesis of secondary metabolites
krh01120  Microbial metabolism in diverse environments
krh01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:krh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KRH_04060
Enzymes [BR:krh01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     KRH_04060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: BAG28753
NITE: KRH_04060
UniProt: B2GGP8
Position
446887..447747
Genome map
AA seq 286 aa AA seqDB search
MTRLPEPLTLSGPHGTGAVLSYGAHAVSWAPEGHEPVLWMSSRAYSETGRALRGGVPLCF
PWFGPGRTGEMEPAHGFARITEWALTEQGEDQHGDPFAEFTLTPEDVSDELRAPFPHEFA
ARFRMTAGRRLRLELTVTNTGSDTFEVEEALHTYLHVGDATRITLSGLDGVSYYDKVAKE
QRTQVGGLRLTGETDAVFAHRGEVHVDDPALDRVLVLGKEGSDSTVVWNPWADKAVGISD
FGDDEWRTMVCVEAGNVMGSPVRLAAGESHTIAQTVEVRARDSGQA
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgacacgactgcccgaacccctgaccctgtcgggcccccacggcaccggcgccgtgctg
agctacggcgcccacgcggtctcctgggccccggaggggcacgagcccgtcctgtggatg
tcctcgcgggcctacagcgagaccggccgggcgctgcgcggcggggtgcccctgtgcttc
ccgtggttcggccccgggcgcacgggggagatggaacccgcccacggcttcgcgcggatc
accgagtgggcgctcacggagcagggcgaggaccagcacggtgaccccttcgcggagttc
accctcacgcccgaggacgtctccgacgagctgcgcgcaccgttcccccacgagttcgcc
gcccggttccggatgaccgcggggcgcaggctgcgcctggagctcacggtcacgaacacg
ggctccgataccttcgaggtcgaggaggccctgcacacctacctgcacgtgggggacgcc
acccggatcacgctctccggactggacggcgtgtcctactacgacaaggtggccaaggag
cagcgcacccaggtgggcgggctgcgcctcacgggcgagaccgacgccgtgttcgcccac
cgcggcgaggtgcacgtggacgaccccgccctggaccgcgtgctggtgctcggcaaggag
ggctcggacagcaccgtggtgtggaacccgtgggcggacaaggccgtggggatcagcgac
ttcggggacgacgagtggcggaccatggtgtgcgtcgaggccggcaacgtgatgggctcc
ccggtgcgcctggcggcgggggagtcccacacgatcgcccagaccgtcgaggtgcgggct
cgggactccgggcaggcctga

DBGET integrated database retrieval system