KEGG   Kocuria rhizophila: KRH_05680Help
Entry
KRH_05680         CDS       T00701                                 

Gene name
folA
Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
krh  Kocuria rhizophila
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:krh00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:krh00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(624800..625351)
Genome map
AA seq 183 aa AA seqDB search
MVGAIWAQSPDGVIGVDGGIPWHLSEDLKFFARTTIGHPVIMGRRTWESFPEQFRPLPGR
PNIVITSRPESVPADGERVWAVGSYAEALELAVSLLAAPGPEHEEPAREVWVIGGPGVWR
EAVSHRPLPLTRALVTTVDLDVTGDTHAPALDGSWSRREVAGWTEARNGTWFRIDEWTRT
PVG
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
gtggtgggggccatctgggcgcagagtcccgacggcgtgatcggggtggacggcgggatc
ccgtggcacctgtccgaggacctgaagttcttcgcgcgcaccaccatcgggcaccccgtg
atcatgggtcggcgcacgtgggagtccttccccgagcagttccgcccgctgccgggacgc
ccgaacatcgtgatcacgtcccgccccgagtccgtgcccgcggacggcgagcgcgtgtgg
gccgtgggttcctacgccgaggcgctggagctcgccgtgtccctgctggcggctcccgga
ccggagcacgaggagcccgcccgcgaggtgtgggtgatcggcgggccgggcgtgtggcgc
gaggccgtgtcccaccgtccgctgccgctgacccgggccctggtgaccaccgtggacctg
gacgtcaccggggacacccacgcccccgcactggacggctcctggtcccgccgtgaggtg
gcgggctggacggaggcgcgcaacggcacctggttccggatcgacgagtggacgcgtacc
cccgtggggtag

DBGET integrated database retrieval system