KEGG   Kocuria rhizophila: KRH_06880Help
Entry
KRH_06880         CDS       T00701                                 

Gene name
galU
Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
krh  Kocuria rhizophila
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:krh00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:krh00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:krh00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:krh00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
748973..749881
Genome map
AA seq 302 aa AA seqDB search
MSPHEMKRVHKAVIPAAGLGTRFLPATKAMPKEMLPVVDRPAIQYVVQEAVDAGLDDVLM
ITGRSKRALEDHFDRVPALEAQLKESGKDALLAGVEHASELGEIHYLRQQDPKGLGHAVL
RAKTHVGQDPFAVLLGDDLIDEKEDLLSRMIEVQERTGGSVVALMEVPRENISAYGCADV
TVLEGEDHVRINGLVEKPAPEDAPSNLAIIGRYVLHPEIFEILENTAPGRGDEIQLTDAM
QTIADRGDSAHGMYGVVFKGRRFDTGDKLSYLKANIELACEREDLGPGLRSWIKDYAQTL
ES
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgagcccacacgagatgaagcgcgttcacaaggccgtcattcccgcggcggggctgggc
acccggttcctgcccgccaccaaggccatgcccaaggagatgctgccggtcgtggaccgc
ccggccatccagtacgtggtgcaggaggccgtggacgccggcctcgacgatgtcctcatg
atcaccgggcgctccaagcgggccctggaggaccacttcgaccgcgttcccgcgctcgag
gcgcagctcaaggagtccggcaaggacgccctgctggccggggtggagcacgcctccgag
ctcggcgagatccactacctgcgccagcaggatcccaagggtctcggccacgccgtgctg
cgcgccaagacccacgtggggcaggacccgttcgcggtgctgctcggggacgacctcatc
gacgagaaggaggacctgctctcccggatgatcgaggtccaggagcgcacgggcggctcc
gtggtggccctcatggaggtgccccgcgagaacatcagcgcctacggctgcgcggacgtc
acggtgctcgagggtgaggaccacgtccggatcaacgggctcgtggagaagcccgctccc
gaggacgccccctcgaacctcgccatcatcggccgctacgtgctgcacccggagatcttc
gagatcctcgagaacaccgcgcccggccgcggggacgagatccagttgacggacgccatg
cagaccatcgcggaccgcggggacagcgcccacggcatgtacggcgtggtcttcaagggc
cgccgcttcgacaccggggacaagctgtcctacctcaaggccaacatcgaactcgcgtgc
gagcgcgaggacctcggccccggtctgcgctcctggatcaaggactacgcccagaccctc
gagtcctga

DBGET integrated database retrieval system