KEGG   Kocuria rhizophila: KRH_07610Help
Entry
KRH_07610         CDS       T00701                                 

Gene name
adh
Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
krh  Kocuria rhizophila
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:krh00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    KRH_07610 (adh)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KRH_07610 (adh)
  Lipid metabolism
   00071 Fatty acid degradation
    KRH_07610 (adh)
  Amino acid metabolism
   00350 Tyrosine metabolism
    KRH_07610 (adh)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    KRH_07610 (adh)
   00626 Naphthalene degradation
    KRH_07610 (adh)
Enzymes [BR:krh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     KRH_07610 (adh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
827223..828233
Genome map
AA seq 336 aa AA seqDB search
MNAAEVEAFGEDLVVGEHEIPEPGPHQALVKLIASGVCHTDLHAAGGDWPVKPKLPLIPG
HEGVGIVEKLGPDVTELEVGQMVGNAWLWSACGNCDHCRTGWETLCEQQVNGGYGIGGSF
GEYMLVDARYAAVIPEGADPYEIAPVLCAGVTVYKGLKQTEVKPGQWVVISGIGGLGHVA
VQYAVAMGMRVVAVDVADDKLALATEHGAEITVNAFAEDPAEVIQEKIGGSHGVLVTAVH
PQAFGQAIGMTRRGGTIVFNGLPPGDFPAPIFDIVLKGLTIRGSIVGTRQDMIEALEFYA
AGKIHPTFSKRPLEDINAIFDEMEHGKIDGRVVIEY
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcagcagaggtcgaggccttcggcgaggacctggtcgtcggcgagcacgagatc
ccggaaccggggccccaccaggccctcgtgaagctcattgcttccggggtgtgccacacg
gacctgcatgccgcgggaggggactggcccgtcaagcccaagcttcccctgatccccggt
cacgagggcgtgggcatcgtggagaagctcggtccggacgtcaccgagctcgaggtcggg
cagatggtcggaaatgcctggctgtggtccgcgtgcggcaactgcgaccactgccgcacc
ggctgggaaacgctgtgcgagcagcaggtcaacggcggctacggcatcggcggctccttc
ggggagtacatgctggtggacgcccgctacgccgctgtcattcccgagggtgcggatccc
tacgagatcgcacccgtgctgtgcgcgggagtgaccgtgtacaaggggctcaagcagacg
gaggtcaagccggggcagtgggtcgtgatctcgggcatcggcgggctcggacacgtggcg
gtgcagtacgcggtggccatgggcatgcgcgtggtggccgtggacgtcgcggacgacaag
ctggcgctggccaccgagcacggcgcggagatcacggtcaacgccttcgccgaggacccc
gcggaggtcatccaggagaagatcggcggcagccacggggtgctcgtcacggcggtgcac
ccgcaggccttcgggcaggccatcggcatgacccggcgcggtggcacgatcgtgttcaac
ggtctgcccccgggggacttcccggctccgattttcgacatcgtgctcaaggggctcact
atccgcgggtcgatcgtgggcacccgccaggacatgatcgaggccctggagttctacgcc
gccggcaagatccaccccacgttcagcaagcgtccgctcgaggacatcaacgcgatcttc
gacgagatggagcacggcaagatcgacggccgtgtggtgatcgagtactga

DBGET integrated database retrieval system