KEGG   Kocuria rhizophila: KRH_08290Help
Entry
KRH_08290         CDS       T00701                                 

Gene name
dapE
Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
krh  Kocuria rhizophila
Pathway
krh00300  Lysine biosynthesis
krh01100  Metabolic pathways
krh01120  Microbial metabolism in diverse environments
krh01230  Biosynthesis of amino acids
Module
krh_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:krh00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    KRH_08290 (dapE)
Enzymes [BR:krh01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     KRH_08290 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: BAG29176
NITE: KRH_08290
UniProt: B2GKP7
Position
896595..897701
Genome map
AA seq 368 aa AA seqDB search
MASDQQTPVLDLTMDPADLTAALVDVESVSDHEGPLADAVEAALRELPHLTVHRDGDTVV
ARTELGRDERVILAGHLDTVPLPTVEGALGAVPSVRRREGDRDVIYGRGTTDMKGGVAVQ
LALVQQLREPNRDVTYVFYDHEEVSSDASGLGRVMRNGPELLEADFAVLLEPTNGTVEGG
CNGTMRFRITTHGKASHSGRAWIGDNAIHKQAELLERLARYEPRTVTVEGLDYREGLNAI
RIGGGVAGNVIPDTAWVEVNYRFAPDKTLQQAQQHVREVFEGYEIEWQDLSPAARPGLDR
PAAAQFVAAVGQEPMPKYGWTDVARFSEAGVPAVNFGPGDALLAHTDDEHVVDDAVRACH
RALSQWLS
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atggcatccgatcagcagacacccgtactcgacctcaccatggaccccgcggacctcacg
gccgcgctcgtggacgtggagtccgtctcggaccacgaggggccgctcgccgacgccgtg
gaggcggccctgcgcgagctgccgcacctcacggtgcaccgggacggggacaccgtggtg
gcccgcaccgagctgggacgggacgagcgggtgatcctggccgggcacctggacaccgtg
cccctgcccaccgtggagggggcgctgggcgcggtgccgtccgtgcggcgtcgtgagggg
gaccgggacgtgatctacggccgcggcaccacggacatgaagggcggggtggcggtgcag
ctcgcgctggtgcagcagctgcgggagccgaaccgggacgtcacgtacgtgttctacgac
cacgaggaggtctccagcgacgccagcggtctggggcgcgtgatgcgcaacgggcccgag
ctgctcgaggcggacttcgcggtgctgctggagcctaccaacggcacggtggagggcggg
tgcaacggcaccatgcgattccggatcaccacccacggcaaggcctcgcactcggggcgc
gcctggatcggggacaacgcgatccacaagcaggcggagctgctggagcggctggcgcgc
tacgagccgcggaccgtcaccgtggagggcctggactaccgcgaggggctcaacgccatc
cggatcggcgggggagtggccggcaacgtgatcccggacaccgcgtgggtggaggtcaac
taccgatttgccccggacaagacgctgcagcaggcgcagcagcacgtgcgcgaggtgttc
gaggggtacgagatcgagtggcaggacctctccccggcggcgcgccccggactggaccgc
cccgccgccgcgcagttcgtggccgcggtgggccaggagcccatgcccaagtacggctgg
acggacgtcgcccgtttctcggaggcaggggtgcccgccgtgaacttcggtccgggggac
gccctgctggcccacacggacgacgagcacgtggtcgacgacgccgtgcgcgcgtgccac
cgggcgctgtcccagtggttgtcctga

DBGET integrated database retrieval system