KEGG   Kocuria rhizophila: KRH_09650Help
Entry
KRH_09650         CDS       T00701                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
krh  Kocuria rhizophila
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:krh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    KRH_09650 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    KRH_09650 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    KRH_09650 (thrC)
Enzymes [BR:krh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     KRH_09650 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1050626..1051735
Genome map
AA seq 369 aa AA seqDB search
MAHVWQGVINEYRDRLPVTERTEVVTMGEGGTPLIPAPALSELTGSTVWLKFEGMNPTGS
FKDRGMTMAITKAKEAGAQAVVCASTGNTSASAAAYAKQAGMRSAVLVPEGKISMGKMSQ
AVAHGADIIQVDGNFDNCLEVARKLSESYPVFLVNSVNPYRIEGQKTAAFEVVDTLGDAP
DIHVLPVGNAGNITAYWKGYREYAQDTPGTSGEVLPAVATRTPAMWGFQAEGAAPLVLGH
PVTEPETIATAIRIGNPASWDTAIAARDESGGLIDAVTDEQILEAHRWLSSREGVFVEPG
SAASVAGLLMKARAGEVPSGATIVATVTGHGLKDPQWAVKGAEAEDARAAEPQRVPFDVV
SVAAALGLA
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atggcacacgtctggcagggcgtcatcaacgagtacagggaccggctgcccgtgactgag
cggaccgaggtggtgaccatgggcgagggcggcaccccgctgatcccggcgcccgcgctg
tccgagctcacgggctccaccgtgtggctgaagttcgagggcatgaaccccacgggctcg
ttcaaggaccgcgggatgaccatggccatcaccaaggccaaggaggccggcgcgcaggcc
gtggtgtgcgcttccacgggcaacacctccgcatccgccgccgcgtacgccaagcaggcc
gggatgcgcagcgcggtgctcgtgcccgagggcaagatctcgatgggcaagatgtcccag
gccgtggcgcacggtgcggacatcatccaggtggacggcaacttcgacaactgcctggag
gtcgcccgcaagctctccgagtcctaccccgtgttcctggtgaactccgtgaacccgtac
cggatcgagggccagaagaccgcggcgttcgaggtggtggacacgctgggcgacgccccg
gacatccacgtgctgcccgtgggcaacgccggcaacatcaccgcgtactggaagggctac
cgcgagtacgcgcaggataccccgggcacctcgggggaggtgctgcccgcggtggccacg
cgcaccccggccatgtggggcttccaggcggagggtgcggccccgctcgtgctgggccac
cccgtgaccgagccggagaccatcgccacggccatccggatcggcaaccccgcgtcgtgg
gacacggcgatcgcggcccgggacgagtccggtgggctcatcgacgccgtcacggacgag
cagatcctggaggcccaccgctggttgtcctcgcgcgagggcgtgttcgtggagccgggc
tccgccgcgagcgtggccgggctgctcatgaaggcgcgcgcgggggaggtgccctcgggc
gccacgatcgtcgccacggtgacgggccacggcctcaaggacccgcagtgggcggtcaag
ggtgccgaggccgaggacgcccgggccgcggagccccagcgcgtgcccttcgacgtcgtg
tccgtcgccgcggccctcggtctcgcgtga

DBGET integrated database retrieval system