KEGG   Kocuria rhizophila: KRH_09650Help
Entry
KRH_09650         CDS       T00701                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
krh  Kocuria rhizophila
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:krh01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:krh00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:krh00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1050626..1051735
Genome map
AA seq 369 aa AA seqDB search
MAHVWQGVINEYRDRLPVTERTEVVTMGEGGTPLIPAPALSELTGSTVWLKFEGMNPTGS
FKDRGMTMAITKAKEAGAQAVVCASTGNTSASAAAYAKQAGMRSAVLVPEGKISMGKMSQ
AVAHGADIIQVDGNFDNCLEVARKLSESYPVFLVNSVNPYRIEGQKTAAFEVVDTLGDAP
DIHVLPVGNAGNITAYWKGYREYAQDTPGTSGEVLPAVATRTPAMWGFQAEGAAPLVLGH
PVTEPETIATAIRIGNPASWDTAIAARDESGGLIDAVTDEQILEAHRWLSSREGVFVEPG
SAASVAGLLMKARAGEVPSGATIVATVTGHGLKDPQWAVKGAEAEDARAAEPQRVPFDVV
SVAAALGLA
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atggcacacgtctggcagggcgtcatcaacgagtacagggaccggctgcccgtgactgag
cggaccgaggtggtgaccatgggcgagggcggcaccccgctgatcccggcgcccgcgctg
tccgagctcacgggctccaccgtgtggctgaagttcgagggcatgaaccccacgggctcg
ttcaaggaccgcgggatgaccatggccatcaccaaggccaaggaggccggcgcgcaggcc
gtggtgtgcgcttccacgggcaacacctccgcatccgccgccgcgtacgccaagcaggcc
gggatgcgcagcgcggtgctcgtgcccgagggcaagatctcgatgggcaagatgtcccag
gccgtggcgcacggtgcggacatcatccaggtggacggcaacttcgacaactgcctggag
gtcgcccgcaagctctccgagtcctaccccgtgttcctggtgaactccgtgaacccgtac
cggatcgagggccagaagaccgcggcgttcgaggtggtggacacgctgggcgacgccccg
gacatccacgtgctgcccgtgggcaacgccggcaacatcaccgcgtactggaagggctac
cgcgagtacgcgcaggataccccgggcacctcgggggaggtgctgcccgcggtggccacg
cgcaccccggccatgtggggcttccaggcggagggtgcggccccgctcgtgctgggccac
cccgtgaccgagccggagaccatcgccacggccatccggatcggcaaccccgcgtcgtgg
gacacggcgatcgcggcccgggacgagtccggtgggctcatcgacgccgtcacggacgag
cagatcctggaggcccaccgctggttgtcctcgcgcgagggcgtgttcgtggagccgggc
tccgccgcgagcgtggccgggctgctcatgaaggcgcgcgcgggggaggtgccctcgggc
gccacgatcgtcgccacggtgacgggccacggcctcaaggacccgcagtgggcggtcaag
ggtgccgaggccgaggacgcccgggccgcggagccccagcgcgtgcccttcgacgtcgtg
tccgtcgccgcggccctcggtctcgcgtga

DBGET integrated database retrieval system