KEGG   Kocuria rhizophila: KRH_09860Help
Entry
KRH_09860         CDS       T00701                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
krh  Kocuria rhizophila
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:krh00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    KRH_09860 (murA)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    KRH_09860 (murA)
Enzymes [BR:krh01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     KRH_09860 (murA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1073037..1074320
Genome map
AA seq 427 aa AA seqDB search
MEETIEVHGPTVVQGRLPVYGAKNSVLKLMAAALLAPGCSTITNVPEIQDVTVMAELLRR
LGCDVHYDAAGRTVAIDVPEELGHQADYDLVRAMRASISVLGPLMARCRRAEVALPGGDA
IGTRGLDMHRAGLEAMGATLSIERGFLRASAPGGLVGATYRLGYPSVGATENLMTAATTA
RGVTVLENVAREPEIVDIGRMLQAMGARIDGLGTTTLTITGVSALHPVTHRTVADRIVAG
TWAFAAAVTGGTVEIAGAEPEHMAVVLDKLRAAGCEITTGQGVLTVRGPERPRAINVSTL
PYPGFPTDLQPFVVALNAVAEGSGIITENVFEARWGFTAELERLGARVHLDGHHARVDGV
PARTLSGAPVEAMDIRAGAALVIAGMAAEGTTEVSGVEHIDRGYEHFVENLSAAGVAVQR
RVSAGRG
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtggaagagacgatcgaggttcacggacccacggtggtccaggggcggctgcccgtgtac
ggggccaagaacagtgtgctcaagctcatggccgcggccctgctcgccccgggctgctcc
accatcaccaacgtcccggagatccaggacgtcaccgtgatggcggagctgctgcgccgg
ctgggctgcgacgtgcactacgacgccgccgggcgaaccgtggcgatcgacgtccccgag
gagctgggtcaccaggccgactacgacctcgtgcgcgccatgcgtgcctcgatctccgtg
ttgggtccgctgatggcccgctgccggcgtgcggaggtcgcgctgccgggcggcgacgcg
atcggcacccgcggtctggacatgcaccgtgcggggctcgaggccatgggcgcgacactg
agcatcgagcgggggttcctgcgcgcgagcgcccccggcggactcgtgggcgccacctac
cgcctcggctatccgtccgtcggtgccaccgagaacctcatgacggcggccaccacggcg
cggggggtcaccgttctggagaacgtggcgcgtgagcccgagatcgtggacatcgggcgc
atgctccaggccatgggtgccaggatcgacgggctgggcaccaccacgctgaccatcacg
ggcgtgtcagccctgcacccggtgacgcaccggaccgtggcggatcgcatcgtggccggc
acgtgggcgttcgcggccgccgtcacgggcgggacggtggagatcgccggagcggagccg
gagcacatggccgtggtgctggacaagctgcgcgcggccggctgcgagatcaccacgggg
cagggggtactcacggtcaggggacccgagcggccgcgggcgatcaacgtgtccacgctg
ccgtacccgggcttccccacggatctgcagccgttcgtggtggccctcaacgcggtggcg
gaggggtccgggatcatcaccgagaacgtgttcgaggcccgctggggcttcaccgcggag
ctggaacggctcggggccagggtgcacctggacggccaccacgcccgggtggacggcgtg
cccgctcgcactctctcgggcgctcccgtcgaggccatggacatccgcgccggagcggcc
ctggtgatcgcgggcatggccgcggagggcaccacggaggtctccggggtggagcacatc
gaccggggctacgagcacttcgtggagaacctctccgccgccggggtggccgtccagcgc
agggtcagcgcgggccgcggctga

DBGET integrated database retrieval system