KEGG   Kocuria rhizophila: KRH_09860Help
Entry
KRH_09860         CDS       T00701                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
krh  Kocuria rhizophila
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:krh00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:krh00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1073037..1074320
Genome map
AA seq 427 aa AA seqDB search
MEETIEVHGPTVVQGRLPVYGAKNSVLKLMAAALLAPGCSTITNVPEIQDVTVMAELLRR
LGCDVHYDAAGRTVAIDVPEELGHQADYDLVRAMRASISVLGPLMARCRRAEVALPGGDA
IGTRGLDMHRAGLEAMGATLSIERGFLRASAPGGLVGATYRLGYPSVGATENLMTAATTA
RGVTVLENVAREPEIVDIGRMLQAMGARIDGLGTTTLTITGVSALHPVTHRTVADRIVAG
TWAFAAAVTGGTVEIAGAEPEHMAVVLDKLRAAGCEITTGQGVLTVRGPERPRAINVSTL
PYPGFPTDLQPFVVALNAVAEGSGIITENVFEARWGFTAELERLGARVHLDGHHARVDGV
PARTLSGAPVEAMDIRAGAALVIAGMAAEGTTEVSGVEHIDRGYEHFVENLSAAGVAVQR
RVSAGRG
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtggaagagacgatcgaggttcacggacccacggtggtccaggggcggctgcccgtgtac
ggggccaagaacagtgtgctcaagctcatggccgcggccctgctcgccccgggctgctcc
accatcaccaacgtcccggagatccaggacgtcaccgtgatggcggagctgctgcgccgg
ctgggctgcgacgtgcactacgacgccgccgggcgaaccgtggcgatcgacgtccccgag
gagctgggtcaccaggccgactacgacctcgtgcgcgccatgcgtgcctcgatctccgtg
ttgggtccgctgatggcccgctgccggcgtgcggaggtcgcgctgccgggcggcgacgcg
atcggcacccgcggtctggacatgcaccgtgcggggctcgaggccatgggcgcgacactg
agcatcgagcgggggttcctgcgcgcgagcgcccccggcggactcgtgggcgccacctac
cgcctcggctatccgtccgtcggtgccaccgagaacctcatgacggcggccaccacggcg
cggggggtcaccgttctggagaacgtggcgcgtgagcccgagatcgtggacatcgggcgc
atgctccaggccatgggtgccaggatcgacgggctgggcaccaccacgctgaccatcacg
ggcgtgtcagccctgcacccggtgacgcaccggaccgtggcggatcgcatcgtggccggc
acgtgggcgttcgcggccgccgtcacgggcgggacggtggagatcgccggagcggagccg
gagcacatggccgtggtgctggacaagctgcgcgcggccggctgcgagatcaccacgggg
cagggggtactcacggtcaggggacccgagcggccgcgggcgatcaacgtgtccacgctg
ccgtacccgggcttccccacggatctgcagccgttcgtggtggccctcaacgcggtggcg
gaggggtccgggatcatcaccgagaacgtgttcgaggcccgctggggcttcaccgcggag
ctggaacggctcggggccagggtgcacctggacggccaccacgcccgggtggacggcgtg
cccgctcgcactctctcgggcgctcccgtcgaggccatggacatccgcgccggagcggcc
ctggtgatcgcgggcatggccgcggagggcaccacggaggtctccggggtggagcacatc
gaccggggctacgagcacttcgtggagaacctctccgccgccggggtggccgtccagcgc
agggtcagcgcgggccgcggctga

DBGET integrated database retrieval system