KEGG   Kocuria rhizophila: KRH_09960Help
Entry
KRH_09960         CDS       T00701                                 

Gene name
pncA
Definition
pyrazinamidase/nicotinamidase (EC:3.5.1.19 3.5.1.-)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
krh  Kocuria rhizophila
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:krh00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(1083982..1084599)
Genome map
AA seq 205 aa AA seqDB search
MRTALLIVDVQNDFCEGGSLAVAGGAAVAAGISEYLEDHHADYAAVAATQDWHVDPGEHF
SDTPDWVTSWPVHCVADTPGAETHPDLDTEHVTEFFRKGAYDAAYSGFEGLSAPDVDVPM
GEPEEAADEDRVSLDDWLRERDVEAVDVVGLALDHCVLATARDAVDAGYETRLLLPLTAP
VSEEGGERAVAELEDVGVEVLTDLP
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcactgcactgctgatcgtggacgtccagaacgacttctgtgagggcggcagcctg
gccgtcgccgggggcgccgcggtggccgcggggatctccgagtacctcgaggaccaccac
gcggactacgccgcggtcgcggccacgcaggactggcacgtggacccgggagagcacttc
agcgacaccccggactgggtcacgagctggcccgtccactgcgtggcggacaccccgggc
gcggagacccacccggacctcgacaccgagcacgtcaccgagttcttccgcaagggcgcg
tacgacgccgcctactcgggtttcgagggattgtccgccccggacgtggacgtccccatg
ggagagcccgaggaggccgcggacgaggaccgcgtgagcctcgacgactggctccgcgag
cgcgacgtcgaggccgtggacgtggtggggctcgccctggaccactgcgtgctggccacc
gcacgcgacgcggtggacgccggctacgagacccggctgctgttgcctctcacggcaccc
gtgtccgaggagggcggcgagcgcgccgtcgcggagctggaggacgtgggggtggaggtc
ctcaccgacctgccctga

DBGET integrated database retrieval system