KEGG   Kocuria rhizophila: KRH_11060Help
Entry
KRH_11060         CDS       T00701                                 

Definition
putative DNA glycosylase (EC:3.2.2.-)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
krh  Kocuria rhizophila
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:krh03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1215526..1216446
Genome map
AA seq 306 aa AA seqDB search
MPEGHSVHRLARQLADLFEGQQLGVSSPQGRFAAGAALLDGRVLTRSRAHGKHLYLDFTA
PGDSSDVLVLRSHLGIYGAWSFAGDETFAAASSIGAPRRLGERESGSAAAAVAYDDAGRV
VPEAPVGAVRVRLAGEHGWADLRGPTLCVAESPEEAAAAAAKLGPDPLDPQADPEPFLAA
AGKSRRPIGVLLMEQHVVAGIGNIFRAESLFRRGVDPMAPGTSLTREDLLELWEENVALM
AVGVRVGRIITTDPEDRPGVPDTEAWPEHANYVYHRHGQPCLRCGATVLKTDLNGRGLYW
CPSCQA
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgagggccactccgtccaccgtctcgcgcgccagctcgcggacctcttcgagggc
cagcagctgggcgtctccagcccgcagggccgcttcgccgccggtgccgcgctgctggac
gggcgcgtgctgacgcgctcgcgggcccacggcaagcacctctacctggacttcaccgcc
ccgggggactcctcggacgtgctcgtgctgcggtcgcacctggggatctacggcgcgtgg
agcttcgcgggggacgagacgttcgcggcggcgtcgtcgatcggtgccccgcggcggttg
ggggagcgcgagtccggttccgccgcggcggctgtggcctacgacgacgccgggcgggtg
gtccccgaggcgcccgtgggtgccgtgcgggtccggctcgcgggcgagcacgggtgggcg
gacctgcgcggccccacactgtgcgtggccgagagccccgaggaggccgccgcggcggcg
gcgaagctcggtccggacccgctggacccgcaggccgaccccgagccgttcctggcggcg
gcggggaagtcccggcggcccatcggcgtgctgcttatggagcagcacgtggtggcgggg
atcggcaacatcttccgcgccgagtccctcttccgccgcggagtggaccccatggccccc
ggaacctcgctcacgcgcgaggacctgctggagctgtgggaggagaacgtggcgctcatg
gccgtgggcgtccgggtgggcaggatcatcaccacggatcctgaggaccgtccgggcgtc
ccggacaccgaggcgtggcccgagcacgccaactacgtctaccaccgccacgggcagccg
tgcctgcggtgcggggccaccgtgctgaagacggacctcaacggccgcgggctgtactgg
tgcccgagctgccaggcgtga

DBGET integrated database retrieval system