KEGG   Kocuria rhizophila: KRH_11060Help
Entry
KRH_11060         CDS       T00701                                 

Definition
putative DNA glycosylase (EC:3.2.2.-)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
krh  Kocuria rhizophila
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:krh00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    KRH_11060
Enzymes [BR:krh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     KRH_11060
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     KRH_11060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1215526..1216446
Genome map
AA seq 306 aa AA seqDB search
MPEGHSVHRLARQLADLFEGQQLGVSSPQGRFAAGAALLDGRVLTRSRAHGKHLYLDFTA
PGDSSDVLVLRSHLGIYGAWSFAGDETFAAASSIGAPRRLGERESGSAAAAVAYDDAGRV
VPEAPVGAVRVRLAGEHGWADLRGPTLCVAESPEEAAAAAAKLGPDPLDPQADPEPFLAA
AGKSRRPIGVLLMEQHVVAGIGNIFRAESLFRRGVDPMAPGTSLTREDLLELWEENVALM
AVGVRVGRIITTDPEDRPGVPDTEAWPEHANYVYHRHGQPCLRCGATVLKTDLNGRGLYW
CPSCQA
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgagggccactccgtccaccgtctcgcgcgccagctcgcggacctcttcgagggc
cagcagctgggcgtctccagcccgcagggccgcttcgccgccggtgccgcgctgctggac
gggcgcgtgctgacgcgctcgcgggcccacggcaagcacctctacctggacttcaccgcc
ccgggggactcctcggacgtgctcgtgctgcggtcgcacctggggatctacggcgcgtgg
agcttcgcgggggacgagacgttcgcggcggcgtcgtcgatcggtgccccgcggcggttg
ggggagcgcgagtccggttccgccgcggcggctgtggcctacgacgacgccgggcgggtg
gtccccgaggcgcccgtgggtgccgtgcgggtccggctcgcgggcgagcacgggtgggcg
gacctgcgcggccccacactgtgcgtggccgagagccccgaggaggccgccgcggcggcg
gcgaagctcggtccggacccgctggacccgcaggccgaccccgagccgttcctggcggcg
gcggggaagtcccggcggcccatcggcgtgctgcttatggagcagcacgtggtggcgggg
atcggcaacatcttccgcgccgagtccctcttccgccgcggagtggaccccatggccccc
ggaacctcgctcacgcgcgaggacctgctggagctgtgggaggagaacgtggcgctcatg
gccgtgggcgtccgggtgggcaggatcatcaccacggatcctgaggaccgtccgggcgtc
ccggacaccgaggcgtggcccgagcacgccaactacgtctaccaccgccacgggcagccg
tgcctgcggtgcggggccaccgtgctgaagacggacctcaacggccgcgggctgtactgg
tgcccgagctgccaggcgtga

  All links  
No link information was found.   
DBGET integrated database retrieval system