KEGG   Kocuria rhizophila: KRH_11800Help
Entry
KRH_11800         CDS       T00701                                 

Gene name
trpC_trpB
Definition
(GenBank) indole-3-glycerol-phosphate synthase/tryptophan synthase beta chain (EC:4.1.1.48 4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
krh  Kocuria rhizophila
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:krh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    KRH_11800 (trpC_trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    KRH_11800 (trpC_trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    KRH_11800 (trpC_trpB)
Enzymes [BR:krh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     KRH_11800 (trpC_trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
1301593..1303752
Genome map
AA seq 719 aa AA seqDB search
MTQQHTGTVLDRIIEGVREDLETRRAQVSLQEVQRAAAEQTPALDVEAALRGSDPASVQV
IAEVKRSSPSKGALAQITDPAELAAAYERGGASVISVLTEQRRFGGSLADLDAVRRAVGI
PVLRKDFVVEEYQVWEARAHGADLVLLIVAALDDAALARLLELTHHLGMHALVETHTEDE
VARAVAVGARIIGVNTRDLKSLDVDVHTFGRLAPLAPEGAVLVAESGVAGEDQIRLYAGH
GAHAVLAGEALVTATDPAQRIARFREVGALARGEFLAGATPPAAQAEHAAAQAQHADDAA
GSLRDAPGPYFGDFGGRWMPESLVAALDELTETFEKARTDEEFLAEFSRLSRDYSGRPSL
LTEAERFGQALGVRVFLKREDLNHTGSHKINNVLGQALLARRMGKTRLIAETGAGQHGVA
TATAAALFGMQCTVYMGEEDTRRQALNVARMRLLGAEVVAVSNGSRTLKDAINEALRDWV
ASVDTTHYLLGTAAGPHPFPAMVRYFHEQIGEEARAQILEQAGRLPDAVTACVGGGSNAI
GIFHGFLDDASVQLYGNEAGGDGVSTGRHAATISLGRPGVLHGARTFLMQDTDGQTVESH
SISAGLDYPAVGPEHSYLHSIGRVSYEAVTDEQAMDAFRLLCLTEGIIPAIESSHALAGA
RAVAERWVEELGPEAAAEKIIVVSLSGRGDKDVATAAEWFDMLPQDSHEERVGQKGEQL
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagcagcacaccggcacggtgctggacaggatcatcgagggggtgcgcgaggac
ctcgagacccgcagggcgcaggtgagcctgcaggaggtgcagcgcgcggccgccgagcag
acgcccgcgctcgacgtggaggcggccctgaggggctcggaccccgcctccgtgcaggtc
atcgcggaggtcaagcgctcgagcccctccaagggcgcgctcgcgcagatcacggatccc
gcggagctcgccgcggcgtacgagcgcgggggcgcatccgtgatctcggtgctcaccgag
cagcgccgcttcgggggttccctcgcggacctcgacgccgtgcggcgcgcggtggggatc
cccgtgctgcgcaaggacttcgtggtcgaggagtaccaggtgtgggaggcccgtgcccac
ggtgcggacctcgtgctgctgatcgtggccgcactcgacgacgccgcgctcgcccggctg
ctggagctcacccaccacctgggcatgcacgccctcgtggagacccacaccgaggacgag
gtggcgcgcgccgtcgcggtcggggcgcgcatcatcggcgtgaacacccgggacctcaag
agcctggacgtggacgtgcacaccttcggtcggctcgccccgctggctccggagggcgcc
gtgctggtcgcggagtccggggtggccggggaggaccagatccggctgtacgcgggccac
ggcgcccacgccgtgctcgccggggaggcgctcgtcaccgccacggaccccgcccagagg
atcgcccggttccgcgaggtgggagccctggcgcgcggcgagttcctggccggggccacc
ccgcccgcggcccaggccgagcacgccgccgcacaggcgcagcacgccgacgacgccgcg
ggctccctgcgcgacgcccccggcccgtacttcggggacttcggcggacgctggatgccc
gagtccctcgtggcggcgctcgacgagctcaccgagaccttcgagaaggcccgcacggac
gaggagttcctcgccgagttctcccggctctcccgcgactactcgggccggccctcgctg
ctgaccgaggcggagcgcttcgggcaggccctcggggtgcgcgtgttcctcaagcgcgag
gacctcaaccacaccggttcccacaagatcaacaacgtgctgggccaggccctgctggcc
cggcgcatgggcaagacccggctgatcgccgagaccggcgcgggccagcacggtgtggcc
accgcgaccgccgcggccctgttcgggatgcagtgcaccgtctacatgggcgaggaggac
acccggcgccaggcgctgaacgtggcccggatgcgcctgctcggcgccgaggtggtggcg
gtgagcaacggctcccgcaccctgaaggacgccatcaacgaggccctgcgggactgggtg
gcctcggtggacaccacgcactacctgctgggcacggccgccggaccccatccgttcccc
gccatggtccgctacttccacgagcagatcggcgaggaggcccgcgcgcagatcctcgag
caggccggtcgcctgccggacgccgtgaccgcgtgcgtgggcggcggctccaacgcgatc
gggatcttccacggcttcctggacgacgcctccgtgcagctctacggcaacgaggccggc
ggcgacggcgtgtccaccggtcggcacgcggcaaccatctccctgggccgcccgggcgtg
ctgcacggcgcgaggacgttcctgatgcaggacaccgacgggcagaccgtggagtcccac
tcgatctccgcgggcctggactacccggcggtcggcccggagcactcctacctgcactcg
atcgggcgcgtgtcctacgaggccgtgaccgacgaacaggccatggacgccttccggctg
ctgtgcctcaccgagggcatcatcccggccatcgagtcctcgcacgccctggccggcgcg
cgggcggtggccgagcgctgggtcgaggagctcggcccggaggccgcggcggagaagatc
atcgtggtgtccctgtccgggcgtggggacaaggacgtcgccacggccgcggagtggttc
gacatgctcccgcaggacagccacgaggaacgcgtgggacagaaaggcgaacagctgtga

DBGET integrated database retrieval system