KEGG   Kocuria rhizophila: KRH_11800Help
Entry
KRH_11800         CDS       T00701                                 

Gene name
trpC_trpB
Definition
bifunctional phosphoribosylanthranilate isomerase/tryptophan synthase subunit beta (EC:4.1.1.48 4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
krh  Kocuria rhizophila
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:krh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    KRH_11800 (trpC_trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    KRH_11800 (trpC_trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    KRH_11800 (trpC_trpB)
Enzymes [BR:krh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     KRH_11800 (trpC_trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1301593..1303752
Genome map
AA seq 719 aa AA seqDB search
MTQQHTGTVLDRIIEGVREDLETRRAQVSLQEVQRAAAEQTPALDVEAALRGSDPASVQV
IAEVKRSSPSKGALAQITDPAELAAAYERGGASVISVLTEQRRFGGSLADLDAVRRAVGI
PVLRKDFVVEEYQVWEARAHGADLVLLIVAALDDAALARLLELTHHLGMHALVETHTEDE
VARAVAVGARIIGVNTRDLKSLDVDVHTFGRLAPLAPEGAVLVAESGVAGEDQIRLYAGH
GAHAVLAGEALVTATDPAQRIARFREVGALARGEFLAGATPPAAQAEHAAAQAQHADDAA
GSLRDAPGPYFGDFGGRWMPESLVAALDELTETFEKARTDEEFLAEFSRLSRDYSGRPSL
LTEAERFGQALGVRVFLKREDLNHTGSHKINNVLGQALLARRMGKTRLIAETGAGQHGVA
TATAAALFGMQCTVYMGEEDTRRQALNVARMRLLGAEVVAVSNGSRTLKDAINEALRDWV
ASVDTTHYLLGTAAGPHPFPAMVRYFHEQIGEEARAQILEQAGRLPDAVTACVGGGSNAI
GIFHGFLDDASVQLYGNEAGGDGVSTGRHAATISLGRPGVLHGARTFLMQDTDGQTVESH
SISAGLDYPAVGPEHSYLHSIGRVSYEAVTDEQAMDAFRLLCLTEGIIPAIESSHALAGA
RAVAERWVEELGPEAAAEKIIVVSLSGRGDKDVATAAEWFDMLPQDSHEERVGQKGEQL
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagcagcacaccggcacggtgctggacaggatcatcgagggggtgcgcgaggac
ctcgagacccgcagggcgcaggtgagcctgcaggaggtgcagcgcgcggccgccgagcag
acgcccgcgctcgacgtggaggcggccctgaggggctcggaccccgcctccgtgcaggtc
atcgcggaggtcaagcgctcgagcccctccaagggcgcgctcgcgcagatcacggatccc
gcggagctcgccgcggcgtacgagcgcgggggcgcatccgtgatctcggtgctcaccgag
cagcgccgcttcgggggttccctcgcggacctcgacgccgtgcggcgcgcggtggggatc
cccgtgctgcgcaaggacttcgtggtcgaggagtaccaggtgtgggaggcccgtgcccac
ggtgcggacctcgtgctgctgatcgtggccgcactcgacgacgccgcgctcgcccggctg
ctggagctcacccaccacctgggcatgcacgccctcgtggagacccacaccgaggacgag
gtggcgcgcgccgtcgcggtcggggcgcgcatcatcggcgtgaacacccgggacctcaag
agcctggacgtggacgtgcacaccttcggtcggctcgccccgctggctccggagggcgcc
gtgctggtcgcggagtccggggtggccggggaggaccagatccggctgtacgcgggccac
ggcgcccacgccgtgctcgccggggaggcgctcgtcaccgccacggaccccgcccagagg
atcgcccggttccgcgaggtgggagccctggcgcgcggcgagttcctggccggggccacc
ccgcccgcggcccaggccgagcacgccgccgcacaggcgcagcacgccgacgacgccgcg
ggctccctgcgcgacgcccccggcccgtacttcggggacttcggcggacgctggatgccc
gagtccctcgtggcggcgctcgacgagctcaccgagaccttcgagaaggcccgcacggac
gaggagttcctcgccgagttctcccggctctcccgcgactactcgggccggccctcgctg
ctgaccgaggcggagcgcttcgggcaggccctcggggtgcgcgtgttcctcaagcgcgag
gacctcaaccacaccggttcccacaagatcaacaacgtgctgggccaggccctgctggcc
cggcgcatgggcaagacccggctgatcgccgagaccggcgcgggccagcacggtgtggcc
accgcgaccgccgcggccctgttcgggatgcagtgcaccgtctacatgggcgaggaggac
acccggcgccaggcgctgaacgtggcccggatgcgcctgctcggcgccgaggtggtggcg
gtgagcaacggctcccgcaccctgaaggacgccatcaacgaggccctgcgggactgggtg
gcctcggtggacaccacgcactacctgctgggcacggccgccggaccccatccgttcccc
gccatggtccgctacttccacgagcagatcggcgaggaggcccgcgcgcagatcctcgag
caggccggtcgcctgccggacgccgtgaccgcgtgcgtgggcggcggctccaacgcgatc
gggatcttccacggcttcctggacgacgcctccgtgcagctctacggcaacgaggccggc
ggcgacggcgtgtccaccggtcggcacgcggcaaccatctccctgggccgcccgggcgtg
ctgcacggcgcgaggacgttcctgatgcaggacaccgacgggcagaccgtggagtcccac
tcgatctccgcgggcctggactacccggcggtcggcccggagcactcctacctgcactcg
atcgggcgcgtgtcctacgaggccgtgaccgacgaacaggccatggacgccttccggctg
ctgtgcctcaccgagggcatcatcccggccatcgagtcctcgcacgccctggccggcgcg
cgggcggtggccgagcgctgggtcgaggagctcggcccggaggccgcggcggagaagatc
atcgtggtgtccctgtccgggcgtggggacaaggacgtcgccacggccgcggagtggttc
gacatgctcccgcaggacagccacgaggaacgcgtgggacagaaaggcgaacagctgtga

DBGET integrated database retrieval system