KEGG   Kocuria rhizophila: KRH_11810Help
Entry
KRH_11810         CDS       T00701                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
krh  Kocuria rhizophila
Pathway
krh00260  Glycine, serine and threonine metabolism
krh00400  Phenylalanine, tyrosine and tryptophan biosynthesis
krh01100  Metabolic pathways
krh01110  Biosynthesis of secondary metabolites
krh01130  Biosynthesis of antibiotics
krh01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:krh00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    KRH_11810 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    KRH_11810 (trpA)
Enzymes [BR:krh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     KRH_11810 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA BtpA PcrB His_biosynth Glyco_tran_WecB
Motif
Other DBs
NCBI-ProteinID: BAG29528
NITE: KRH_11810
UniProt: B2GGV5
Position
1303749..1304606
Genome map
AA seq 285 aa AA seqDB search
MSTTGTPETAPTGLAARILPAGLTDRGESALSRRIEQCRDEGRPALVGYLPAGYPNLEES
VAAAVALGRNGADVIEIGIPYSDPVMDGPVIQAATTQSLANGFHVADVFTVVRAVAEQTD
AVPVVMTYWNPVLQTGVDEFARRLAEAGGAGIITPDLIPDEAGQWFAASEEHGLDRIFLV
APSTTRERMDMTVAAASGFLYAVSVMGVTGARDEVSSAAEDVVARARAAGAQRVCVGLGV
SRREHVLEIGRYADGVIVGTALVRALGEGGAEAVGRLAAELAGRA
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaccaccggaacccctgagaccgcacccaccgggctggccgcgcgaatccttccc
gcgggcctcacggaccgcggcgagtccgcgctgtcccgccggatcgagcagtgccgcgac
gaaggacgccccgcgctcgtgggctacctccccgcggggtaccccaacctcgaggagtcc
gtggcggccgcggtggccctgggccgcaacggcgcggacgtcatcgagatcggcatcccg
tactcggaccccgtgatggacgggcccgtgatccaggccgcgaccacgcagtccctggcc
aacggcttccacgtggcggacgtgttcaccgtggtgcgcgccgtggccgagcagacggac
gcggtgcccgtggtcatgacctactggaaccccgtgctgcagaccggcgtggacgagttc
gcgcgccggctggcggaggccgggggagccgggatcatcaccccggacctcatcccggac
gaggcggggcagtggttcgccgcctccgaggagcacgggctggaccggatcttcctggtg
gcgccctccaccacccgtgagcgcatggacatgaccgtggccgcggcctcgggcttcctc
tacgccgtgtcggtcatgggcgtcacgggcgcccgggacgaggtctcctcggccgcagag
gacgtcgtggcccgggcgcgggccgccggtgcgcagcgggtgtgcgtgggcctgggggtg
tcccgccgcgagcacgtgctggagatcggccgctacgcggacggcgtgatcgtgggcacc
gccctcgtgcgggccctcggcgagggcggtgccgaggccgtgggccgcctcgccgccgag
ctcgcggggcgcgcatga

DBGET integrated database retrieval system