KEGG   Kocuria rhizophila: KRH_11810Help
Entry
KRH_11810         CDS       T00701                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
krh  Kocuria rhizophila
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:krh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    KRH_11810 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    KRH_11810 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    KRH_11810 (trpA)
Enzymes [BR:krh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     KRH_11810 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
1303749..1304606
Genome map
AA seq 285 aa AA seqDB search
MSTTGTPETAPTGLAARILPAGLTDRGESALSRRIEQCRDEGRPALVGYLPAGYPNLEES
VAAAVALGRNGADVIEIGIPYSDPVMDGPVIQAATTQSLANGFHVADVFTVVRAVAEQTD
AVPVVMTYWNPVLQTGVDEFARRLAEAGGAGIITPDLIPDEAGQWFAASEEHGLDRIFLV
APSTTRERMDMTVAAASGFLYAVSVMGVTGARDEVSSAAEDVVARARAAGAQRVCVGLGV
SRREHVLEIGRYADGVIVGTALVRALGEGGAEAVGRLAAELAGRA
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaccaccggaacccctgagaccgcacccaccgggctggccgcgcgaatccttccc
gcgggcctcacggaccgcggcgagtccgcgctgtcccgccggatcgagcagtgccgcgac
gaaggacgccccgcgctcgtgggctacctccccgcggggtaccccaacctcgaggagtcc
gtggcggccgcggtggccctgggccgcaacggcgcggacgtcatcgagatcggcatcccg
tactcggaccccgtgatggacgggcccgtgatccaggccgcgaccacgcagtccctggcc
aacggcttccacgtggcggacgtgttcaccgtggtgcgcgccgtggccgagcagacggac
gcggtgcccgtggtcatgacctactggaaccccgtgctgcagaccggcgtggacgagttc
gcgcgccggctggcggaggccgggggagccgggatcatcaccccggacctcatcccggac
gaggcggggcagtggttcgccgcctccgaggagcacgggctggaccggatcttcctggtg
gcgccctccaccacccgtgagcgcatggacatgaccgtggccgcggcctcgggcttcctc
tacgccgtgtcggtcatgggcgtcacgggcgcccgggacgaggtctcctcggccgcagag
gacgtcgtggcccgggcgcgggccgccggtgcgcagcgggtgtgcgtgggcctgggggtg
tcccgccgcgagcacgtgctggagatcggccgctacgcggacggcgtgatcgtgggcacc
gccctcgtgcgggccctcggcgagggcggtgccgaggccgtgggccgcctcgccgccgag
ctcgcggggcgcgcatga

DBGET integrated database retrieval system