KEGG   Kocuria rhizophila: KRH_14420Help
Entry
KRH_14420         CDS       T00701                                 

Definition
(GenBank) dihydrolipoamide acyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
krh  Kocuria rhizophila
Pathway
krh00020  Citrate cycle (TCA cycle)
krh00310  Lysine degradation
krh01100  Metabolic pathways
krh01110  Biosynthesis of secondary metabolites
krh01120  Microbial metabolism in diverse environments
krh01130  Biosynthesis of antibiotics
krh01200  Carbon metabolism
Module
krh_M00009  Citrate cycle (TCA cycle, Krebs cycle)
krh_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:krh00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    KRH_14420
  Amino acid metabolism
   00310 Lysine degradation
    KRH_14420
Enzymes [BR:krh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     KRH_14420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H Biotin_lipoyl_2 WYL
Motif
Other DBs
NCBI-ProteinID: BAG29789
NITE: KRH_14420
UniProt: B2GJ84
Position
1628674..1630899
Genome map
AA seq 741 aa AA seqDB search
MSETVNLPALGESVTEGTVTRWLKQVGEEVAVDEPLVEVSTDKVDTEVPSPVAGVIEKIL
VDEDEDVEVGAPLVVIGDGSGDSGSDDSSQDAAAQEDSTDESQDEEQAAEIKTEQAPKAD
TKQASGNSVEVTLPALGESVTEGTVTRWLKQVGESIEVDEPLLEVSTDKVDTEVPSPVAG
TILEIKVQEDEDAEVGQVLAIVGDESAASSDAGSDSDNGSSETSGETKAEKVEDAATAAD
SGENTEQAAEIKTEQAPKADTKQASGNSVEVTLPALGESVTEGTVTRWLKQVGESIEVDE
PLLEVSTDKVDTEVPSPVAGTILEIKVQEDEDAEVGQVLAIVGDESAASSDAGSDSDNGS
SETSGETKAEKVEDAATAADSGENTEQAAEIKTEQAPKADTKQASGKAGSEQSSTGNAGT
DVPGYVTPLVRKLAREKNVDLSTLTGTGVGGRIRKQDVLAAAEKSETSSAPAIQDTGADM
APAVSQQGSAKAPEAAPAPDAKRGTTEKAPRIRMTIAKRMRESLDVSAQLTQVTEVDMTR
VAKLRQQAKDQFQKREGAKLTFMPFFAKAVAEALQAHPVLNATFKEESKEIVYNSSEDIA
IAVDTPRGLLVPVVKNAGDLNLGGLAKQIAELGASAKDGSISPDALAGGTFTITNIGSFG
ALFDTPIINQPQVGILGTGSIVKRPMVVTDAEGNDTIAIRHMCYLSLTYDHRLVDGADAG
RFLSTLKKRLEAGQFESEVGL
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagaccgttaacctgcccgcgctgggcgagtctgtcaccgaaggaaccgtcacc
cgctggctcaagcaggtgggcgaggaagtggccgtcgacgagcccctggtggaggtgtcc
acggacaaggtggacaccgaggtcccctcccccgtggccggtgtgatcgagaagatcctg
gtcgatgaggacgaggacgtcgaggtcggcgccccgctggtcgtcatcggcgacggctcc
ggtgactccggttccgacgactcctcccaggacgccgcggcgcaggaggactccaccgac
gagtcccaggacgaggagcaggccgcggagatcaagaccgaacaggccccgaaggcggac
accaagcaggcctcgggcaactcggtggaggtcaccctgcccgcactgggcgagtccgtg
accgagggcaccgtgacccgctggctcaagcaggtcggcgagagcatcgaggtggacgag
cccctgctcgaggtctccaccgacaaggtcgacaccgaggtcccctcccccgtggccggc
acgatcctggagatcaaggtccaggaggacgaggacgccgaggtcggccaggttctggcc
atcgtgggcgacgagtccgcggcgtcctccgatgccgggtccgactccgacaacggctcc
tccgagacctccggcgagaccaaggccgagaaggtcgaggacgccgccaccgccgccgac
tccggtgagaacaccgaacaggccgcggagatcaagaccgaacaggccccgaaggcggac
accaagcaggcctcgggcaactcggtggaggtcaccctgcccgcactgggcgagtccgtg
accgagggcaccgtgacccgctggctcaagcaggtcggcgagagcatcgaggtggacgag
cccctgctcgaggtctccaccgacaaggtcgacaccgaggtcccctcccccgtggccggc
acgatcctggagatcaaggtccaggaggacgaggacgccgaggtcggccaggttctggcc
atcgtgggcgacgagtccgcggcgtcctccgatgccgggtccgactccgacaacggctcc
tccgagacctccggcgagaccaaggccgagaaggtcgaggacgccgccaccgccgccgac
tccggtgagaacaccgaacaggccgcggagatcaagaccgaacaggccccgaaggcggac
accaagcaggcctcgggcaaggctggttcggagcagtcctccaccggcaacgctggcacg
gacgtcccgggctacgtgaccccgctggtgcgcaagctggcccgcgagaagaacgtggac
ctgagcaccctcaccggcaccggtgtgggcggccgcatccgcaagcaggacgtcctcgcc
gcggcggagaagtccgagacgtcctcggcacccgccatccaggacaccggagcggacatg
gccccggccgtgtcccagcagggttctgcgaaggcccccgaggcggctccggccccggac
gccaagcgcggcaccaccgagaaggccccgcgcatccgcatgacgatcgccaagcgtatg
cgcgagtccctggacgtctccgcccagctcacccaggtgaccgaggtggacatgacccgc
gtggccaagcttcgtcagcaggccaaggaccagttccagaagcgcgagggcgccaagctc
acgtttatgcccttcttcgcgaaggccgtggccgaggcactgcaggcgcaccccgtgctc
aacgccaccttcaaggaggagtcgaaggagatcgtctacaactcctccgaggacatcgca
atcgccgtggacaccccgcgcggtctgctggtgccggtggtgaagaacgcgggtgacctc
aacctgggtggtctggccaagcagatcgccgagctgggcgcctccgccaaggacggcagc
atctcgccggacgccctggccggtggcaccttcacgatcaccaacatcggctcgttcggg
gccctgttcgacaccccgatcatcaaccagccgcaggtgggcatcttgggcaccgggtcg
atcgtgaagcgccccatggtggtcacggacgcggagggcaacgacaccatcgccatccgc
cacatgtgctacctgtcgctgacctacgaccaccgcctggtggacggcgccgacgccggg
cgcttcctgagcaccctcaagaagcgtctcgaggctggccagttcgagtccgaggtcggt
ctctga

DBGET integrated database retrieval system