KEGG   Kocuria rhizophila: KRH_15000Help
Entry
KRH_15000         CDS       T00701                                 

Definition
putative esterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
krh  Kocuria rhizophila
Brite
Enzymes [BR:krh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     KRH_15000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1696920..1697711
Genome map
AA seq 263 aa AA seqDB search
MSTQQPDHGPLHLPGTSSVGVLVLHGFTSTTASVRDWARAIHTATDDAGAHPGVSVPLLP
GHGTQWQDLAEQSWQAWRDAVDREYWRLKEHHEHMVVCGLSMGGALALHTAERREVAGVL
LVNPALALVNRAARFSRVLARAVPSLPGIGSDIRRESVLESAYDRTPLAAVAQLNVLMHR
TARMLPAVTAPVIVFRSEEDHVVSGTSADLVARRATGPVRVVPLPDSYHVATLDHDAPLI
EARSRDAVQRISRGEPFLPEVRE
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacgcaacagccagaccacggtcccctgcacctgcccggaacgtcctcggtgggt
gtcctggtgctccacggcttcacgtccaccacggcgtcggtgcgggactgggcccgcgcg
atccacacggccacggacgacgccggggcgcacccgggcgtgagcgtccccttgctgccg
ggccacggcacgcagtggcaggacctcgccgagcagagctggcaagcgtggcgggacgcc
gtggaccgcgagtactggcggttgaaggagcaccacgagcacatggtcgtgtgcgggctc
tcgatgggcggcgccctggccctgcacaccgcggaacggcgcgaggtggccggggtgctg
ctcgtgaaccccgcgctcgcgctggtgaaccgcgccgcccggttcagccgggtgctggcc
cgtgccgtgccgtccctgcccgggatcggcagcgacatccggcgggagtcggtgctcgag
tccgcctacgaccgcaccccgctggcggccgtggcgcagctcaacgtgctcatgcaccgc
acggccaggatgctgcccgcggtgaccgcccccgtgatcgtcttccgctccgaggaggac
cacgtggtctccgggacctccgcggacctggtggcgcggcgcgccacgggcccggtgcgc
gtggtccccctgccggacagctaccacgtggccaccctggaccacgacgccccgctcatc
gaggcccggtcccgggacgcggtgcagcggatctcccgcggtgagccgttcctgccggag
gtccgggagtga

DBGET integrated database retrieval system