KEGG   Kocuria rhizophila: KRH_16160Help
Entry
KRH_16160         CDS       T00701                                 

Gene name
dxr
Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
krh  Kocuria rhizophila
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:krh00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(1833451..1834725)
Genome map
AA seq 424 aa AA seqDB search
MTSPRTMTPDLDRATSAAPRRLVILGSTGSIGTQALDVVERAADLARPESDAQHPPFEVL
ALAAGAGNLELLARQAVRFRVAAVGTSGTADDAARLGELLADAARAASSPVPEVLHGERA
ATELAAWDGADLVLNGITGSIGLAPTLAALGAGHRVALANKESLIAGGPLVTAAAAGTGL
TNALIPVDSEHSAIAQALRSGTAAEVERLVLTASGGPFRGMSRAQLAHVTPEQALRHPTW
DMGAMVTTNSATMVNKALEVLEASLLFDVPLDRIDVTVHPQSVVHSMVQFVDGSTLAQAS
PPDMRLPIALGLAWPHRVPGAAAACDWTRAAEWTFEPLDAEAFPAVELMKHAGALGGTWP
AVFNAANEQAVHAFHRGALGFLQIVELVASVVDEHTGVREPSLEDVLEAERWARARADER
IVRG
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgacttccccacggaccatgacccccgatctcgaccgcgccacgagtgccgcgccccgg
cggctggtgatcctgggctccacggggtccatcggcacgcaggcgctcgacgtcgtggaa
cgggccgcggacctcgcacggccggagtcggacgcccagcacccgccgttcgaggtcctc
gcgctggcggcgggcgcgggcaacctggagctgctcgcgcggcaggccgtgcgcttccgc
gtggccgcggtgggcacgagcggcaccgcggacgacgccgcgcggctgggtgagctgctc
gcggacgccgcgcgggcggcgtcgtcaccggtgcccgaggtgctgcacggcgagcgcgcc
gccacggagctcgccgcgtgggacggcgccgacctggtgctcaacggcatcaccggcagc
atcgggctcgcgcccaccctggccgcgctgggggcggggcaccgggtggcgctggccaac
aaggagtcgctgatcgcgggcggtccgctcgtcacggcggccgctgcgggcacgggcctc
acgaacgctctgatccccgtggattccgagcactccgcgatcgcgcaggcgctgcgctcg
ggcacggcggcggaggtggaacgcctcgtgctcacggcctcgggaggcccgttccggggg
atgagccgcgcgcagctcgcgcacgtgacgccggagcaggcgctgcgccaccccacgtgg
gacatgggtgccatggtcaccaccaactccgccaccatggtcaacaaggcgctcgaggta
ctcgaggcgtccctgctgttcgacgtgcccctcgaccggatcgacgtgaccgtgcacccg
cagtcggtggtgcactcgatggtgcagttcgtggacggctccaccctggcccaggcctcg
cccccggacatgcggctgcccatcgccctgggcctcgcgtggccgcaccgcgtcccgggg
gccgccgcggcgtgcgactggacccgtgccgccgagtggacgttcgagccgctcgacgcc
gaagcgttccccgcggtcgagctcatgaagcacgcgggggccctcggaggcacatggccc
gcggtcttcaacgccgcgaacgagcaggcggtccacgcgttccaccgcggcgcgctcggc
ttcctccagatcgtggagctcgtggcgagcgtggtggacgagcacaccggtgtgcgcgag
ccctccctcgaggacgtgctggaggccgagcggtgggcccgcgcccgggccgacgagcgg
atcgtccggggatag

DBGET integrated database retrieval system