KEGG   Kocuria rhizophila: KRH_16160Help
Entry
KRH_16160         CDS       T00701                                 

Gene name
dxr
Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
krh  Kocuria rhizophila
Pathway
krh00900  Terpenoid backbone biosynthesis
krh01100  Metabolic pathways
krh01110  Biosynthesis of secondary metabolites
krh01130  Biosynthesis of antibiotics
Module
krh_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:krh00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    KRH_16160 (dxr)
Enzymes [BR:krh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     KRH_16160 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXPR_C DXP_redisom_C DXP_reductoisom
Motif
Other DBs
NCBI-ProteinID: BAG29963
NITE: KRH_16160
UniProt: B2GKS7
Position
complement(1833451..1834725)
Genome map
AA seq 424 aa AA seqDB search
MTSPRTMTPDLDRATSAAPRRLVILGSTGSIGTQALDVVERAADLARPESDAQHPPFEVL
ALAAGAGNLELLARQAVRFRVAAVGTSGTADDAARLGELLADAARAASSPVPEVLHGERA
ATELAAWDGADLVLNGITGSIGLAPTLAALGAGHRVALANKESLIAGGPLVTAAAAGTGL
TNALIPVDSEHSAIAQALRSGTAAEVERLVLTASGGPFRGMSRAQLAHVTPEQALRHPTW
DMGAMVTTNSATMVNKALEVLEASLLFDVPLDRIDVTVHPQSVVHSMVQFVDGSTLAQAS
PPDMRLPIALGLAWPHRVPGAAAACDWTRAAEWTFEPLDAEAFPAVELMKHAGALGGTWP
AVFNAANEQAVHAFHRGALGFLQIVELVASVVDEHTGVREPSLEDVLEAERWARARADER
IVRG
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgacttccccacggaccatgacccccgatctcgaccgcgccacgagtgccgcgccccgg
cggctggtgatcctgggctccacggggtccatcggcacgcaggcgctcgacgtcgtggaa
cgggccgcggacctcgcacggccggagtcggacgcccagcacccgccgttcgaggtcctc
gcgctggcggcgggcgcgggcaacctggagctgctcgcgcggcaggccgtgcgcttccgc
gtggccgcggtgggcacgagcggcaccgcggacgacgccgcgcggctgggtgagctgctc
gcggacgccgcgcgggcggcgtcgtcaccggtgcccgaggtgctgcacggcgagcgcgcc
gccacggagctcgccgcgtgggacggcgccgacctggtgctcaacggcatcaccggcagc
atcgggctcgcgcccaccctggccgcgctgggggcggggcaccgggtggcgctggccaac
aaggagtcgctgatcgcgggcggtccgctcgtcacggcggccgctgcgggcacgggcctc
acgaacgctctgatccccgtggattccgagcactccgcgatcgcgcaggcgctgcgctcg
ggcacggcggcggaggtggaacgcctcgtgctcacggcctcgggaggcccgttccggggg
atgagccgcgcgcagctcgcgcacgtgacgccggagcaggcgctgcgccaccccacgtgg
gacatgggtgccatggtcaccaccaactccgccaccatggtcaacaaggcgctcgaggta
ctcgaggcgtccctgctgttcgacgtgcccctcgaccggatcgacgtgaccgtgcacccg
cagtcggtggtgcactcgatggtgcagttcgtggacggctccaccctggcccaggcctcg
cccccggacatgcggctgcccatcgccctgggcctcgcgtggccgcaccgcgtcccgggg
gccgccgcggcgtgcgactggacccgtgccgccgagtggacgttcgagccgctcgacgcc
gaagcgttccccgcggtcgagctcatgaagcacgcgggggccctcggaggcacatggccc
gcggtcttcaacgccgcgaacgagcaggcggtccacgcgttccaccgcggcgcgctcggc
ttcctccagatcgtggagctcgtggcgagcgtggtggacgagcacaccggtgtgcgcgag
ccctccctcgaggacgtgctggaggccgagcggtgggcccgcgcccgggccgacgagcgg
atcgtccggggatag

DBGET integrated database retrieval system