KEGG   Kocuria rhizophila: KRH_17040Help
Entry
KRH_17040         CDS       T00701                                 

Gene name
rmlC
Definition
putative dTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
Orthology
K00067  
dTDP-4-dehydrorhamnose reductase [EC:1.1.1.133]
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
krh  Kocuria rhizophila
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:krh00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:krh00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(1929891..1930871)
Genome map
AA seq 326 aa AA seqDB search
MHTTAIDGLLLVDVPVHGDNRGWFTDNWQRAKAVAAGLPDASFVQNNISFNGSRRTTRGI
HAEPWDKYVSVATGRIFGACVDLREGPGFGTVVTHEITPGTAVFVPRGVGNAFQTLEEAT
AYTYLVTDHWRADATAEYSFVNLGDPQLGIEWPVPLAQAELADKDRAHPALDDVEPLAPA
PLLVLGARGQVGLALTARLSTTGVPFTAWTREELDLANPASWPAEISSAYTRTTPWRRCP
CTAAEARGGDRTAGLPASLRDPHQLGDRGGDELRGHHGAAGRAGGGPLRGRAPARAPHRR
GGPGGGSPAPRGLRRPVRHVPPHRLR
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
gtgcacaccaccgccatcgacgggctgctgctggtggacgtgcccgtccacggggacaac
cgcggctggttcacggataactggcagcgcgccaaggccgtggccgccgggctgccggac
gcctccttcgtgcagaacaacatctcgttcaacggctcccgccgcaccacgcgcggcatc
cacgccgagccgtgggacaagtacgtctccgtggccaccggccggatcttcggcgcgtgc
gtggacctgcgggaggggccgggcttcggcaccgtggtcacgcacgagatcaccccgggc
accgcggtgttcgtgccgcgcggggtgggcaacgcgttccagacactggaggaggccacc
gcctacacctacctggtcacggaccactggcgcgcggacgccacggccgagtactcgttc
gtgaacctgggggacccgcagctgggcatcgagtggcccgtgccgctggcgcaggcggag
ctcgcggacaaggaccgcgcgcaccccgcgctggacgacgtcgagccgctggctcccgcg
ccgttgctcgtgctgggtgcccgcggccaggtgggcctggccctcacggcgcggctgtcg
acgacgggggttccgttcaccgcatggacccgggaggagctggacctcgcgaacccggcc
tcctggcccgcggagatcagctcggcgtacaccaggaccaccccgtggcgccgctgtccg
tgtacggcagccgaagcccgcgggggagaccgcactgcgggcctgcccgcgtcactacgt
gatccgcaccagctgggtgatcggggaggggatgaacttcgtggccaccatggcgcggct
ggccgagcagggggtgggcccctccgtggtcgcgcaccagcacgggcgcctcaccgccgc
ggcggacctggcggcgggagtcccgcacctcgtggactccggcgccccgtacggcacgta
ccacctcaccggctccggtga

DBGET integrated database retrieval system