KEGG   Kocuria rhizophila: KRH_17070Help
Entry
KRH_17070         CDS       T00701                                 

Definition
putative uroporphyrinogen III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
krh  Kocuria rhizophila
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:krh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    KRH_17070
Enzymes [BR:krh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     KRH_17070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1936204..1937043
Genome map
AA seq 279 aa AA seqDB search
MTSHEHPALSGLTVAVTAHRRATEQGGAFERHGARVRYAPALKLTPADEDDGVLAATREL
LASAPGTVLVTTGYGLKRWLAVAREHGLDEELLAALRASSVLSRGAKATGQLRASGIPCA
YTGSSGRTAELVDRLLAGDPAPRGTVTVQVHGTPDEEQLDRLRTAGLPVRTVAPYRWESA
DEGSSLATLVRDAVAGHVDYVTFTAAPAVDAVFDAARTLGALEDFQRALRDGRCTPVAIG
PVCVQPLEEAGIPAVVPERFRLGAMVRAVCDHASEAVSR
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgacgagccacgagcaccccgccctgtccggactgaccgtcgcggtcaccgcccaccgc
cgcgccaccgagcagggtggcgcgttcgaacgccacggcgcgcgggtgcgctacgcgccg
gcgctcaaactcacccccgcggacgaggacgacggcgtgctggccgccacccgggaactg
ctcgcctctgccccgggcaccgtgctggtcaccacgggctacggactcaaacgctggctc
gccgtggcgcgggagcacggtctggacgaggagctgctcgcggcgctgcgcgcgtccagc
gtgctctcgcgcggggcgaaggccacgggacagctgcgggcgagcgggatcccgtgcgcg
tacacgggctcctcgggacgcaccgcggagctcgtggaccggctgctcgccggggatccc
gcaccccgaggcaccgtgacggtccaggtgcacggcacaccggacgaggagcagctggac
cggctgcggaccgcgggtctgcccgtgcgcaccgtggcaccgtaccggtgggagtccgcg
gacgagggctcgagccttgccaccctcgtgcgggacgcggtcgcggggcacgtggactac
gtgaccttcaccgcggcaccggccgtggacgcggtgttcgacgccgcccgcaccctgggc
gcgctcgaggacttccagcgcgccctgcgggacggacgctgcacaccggtggccatcggg
cccgtgtgcgtgcagccgctcgaggaggccgggatccccgccgtggtccccgagcgcttc
cggctcggggccatggtcagggcggtgtgtgatcacgcctcggaggcggtctcccggtag

DBGET integrated database retrieval system