KEGG   Kocuria rhizophila: KRH_17910Help
Entry
KRH_17910         CDS       T00701                                 

Gene name
sdhD
Definition
succinate dehydrogenase hydrophobic membrane anchor protein (EC:1.3.99.1)
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
krh  Kocuria rhizophila
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:krh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KRH_17910 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    KRH_17910 (sdhD)
   00650 Butanoate metabolism
    KRH_17910 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    KRH_17910 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
2031749..2032234
Genome map
AA seq 161 aa AA seqDB search
MSTPLKTKISVPRSRDLEVDGVKYNRSSSSRSSFEMFAWLFMRMSGIVLVVLVFGHLFVN
LMVGEGVHAVDFGFVGGKWANPFWQVWDLVMLWLAMLHGTNGMRTIIDDYAGRNTTRFWL
KVFLFVASAFVILLGTMVIFTFEPCPAGADPSLLASFCHAR
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
gtgagcactcctctcaagaccaagatctccgtcccgcgcagccgggacctcgaggtggac
ggcgtcaagtacaaccgctcctcctcgtcccgcagcagcttcgagatgttcgcgtggctg
ttcatgcgcatgtccggcatcgtgctggtggtgctcgtcttcggccacctcttcgtcaac
ctcatggtgggcgagggcgtgcacgccgtggacttcggcttcgtgggcggcaagtgggcc
aacccgttctggcaggtctgggacctggtcatgctgtggctggccatgctccacggcacc
aacggcatgcgcaccatcattgacgactacgcagggcgcaacaccacgcgcttctggctc
aaggtgttcctgttcgtggcctcggccttcgtgatcctgctgggcaccatggtgatcttc
actttcgagccgtgccccgccggcgccgacccctcgctgctggcctccttctgccacgcc
cggtga

DBGET integrated database retrieval system