KEGG   Kocuria rhizophila: KRH_18370Help
Entry
KRH_18370         CDS       T00701                                 

Gene name
groEL
Definition
chaperonin GroEL
Orthology
K04077  
chaperonin GroEL
Organism
krh  Kocuria rhizophila
Pathway
RNA degradation
Class
Genetic Information Processing; Folding, sorting and degradation; RNA degradation [PATH:krh03018]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(2089249..2090883)
Genome map
AA seq 544 aa AA seqDB search
MAKMIAFDEEARRGLEKGLNTLADAVKVTLGPRGRNVVLEKSWGAPTITNDGVSIAKEIE
LEEPYEKIGAELVKEVAKKTDDVAGDGTTTATVLAQALVKEGLRNVAAGADPLSLKRGIE
KAVASVTEQLLSSAKEIETEEEIAATASISAADPEIGKLIAEAMEKVGKEGVITVEESNT
FGLDLELTEGMRFDKGYLSGYFVTDADRQEAVLEDPYILIVNSKISAVKDLVPVLEKVMQ
AGKPLLIIAEDVDGEALAMLVLNKMRGAVKSVAVKAPGFGDRRKAQLADIAILTGGQVIT
EEVGLSLESATIDLLGQARKVVVTKDETTIVDGAGTQEEIEGRVAQIRAEINNSDSDYDR
EKLQERLAKLAGGVAVLKAGAATEVELKERKHRIEDAVRNAKAAVEEGIVAGGGVALIQA
GAKVFDSLNLSGDEATGANIVKVAIDAPLKQIALNAGMEPGVVVDKVRGLETGWGLNAAT
GEYEDLMAAGINDPVKVTRSALQNAASIAGLFLTTEAVVADKPEPEAAGAGAGADPMGGM
GGMM
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagatgatcgcattcgacgaagaagctcgccgcggcctcgagaagggtctgaac
accctcgcggacgccgtcaaggtcacgctcggcccgcgcggccgcaacgtggtcctggag
aagtcctggggcgctcccaccatcaccaacgacggcgtctccatcgccaaggagatcgag
ctcgaggagccgtacgagaagatcggcgccgagctcgtcaaggaggtcgccaagaagacc
gacgacgtcgccggtgacggcaccaccacggccaccgtgctcgcccaggccctcgtgaag
gaaggcctgcgcaacgtggccgccggtgcggacccgctgtccctcaagcgcggcatcgag
aaggccgtggcctccgtgaccgagcagctgctgtcctccgccaaggagatcgagaccgag
gaggagatcgccgccaccgcgtctatctccgccgcagaccccgagatcggcaagctcatc
gccgaggccatggagaaggtcggcaaggaaggcgtcatcaccgtcgaggagtccaacacc
ttcgggctggacctcgagctgaccgagggcatgcgcttcgacaagggctacctctccggc
tacttcgtcacggacgcggaccgccaggaggccgttctggaggatccctacatcctcatc
gtgaactccaagatctccgccgtgaaggacctggtccccgtgctggagaaggtcatgcag
gccggcaagccgctgctgatcatcgccgaggacgtggacggcgaggccctggccatgctg
gtgctgaacaagatgcgaggcgccgtgaagtccgtggccgtgaaggcccccggcttcggt
gaccgccgcaaggcccagctcgccgacatcgccatcctcaccggcggtcaggtcatcacc
gaagaggtcggcctgtccctcgagtccgccacgatcgacctgctgggccaggcccgcaag
gtcgtcgtcaccaaggacgagaccaccatcgtggacggcgccggcacccaggaggagatc
gagggccgcgtggcgcagatccgcgcggagatcaacaactccgactccgactacgaccgc
gagaagctgcaggagcgcctggccaagctggctggcggcgtggcagtgctcaaggccggt
gcggccaccgaggtggagctcaaggagcgcaagcaccgcatcgaggacgccgtgcgcaac
gccaaggcagccgtggaggagggcatcgtcgccggcggtggcgtggccctcatccaggcc
ggtgccaaggtcttcgactccctgaacctctcgggtgacgaggccaccggtgcgaacatc
gtcaaggtcgccatcgacgccccgctcaagcagatcgccctcaacgcgggcatggagccc
ggcgtggtggtcgacaaggtgcgcgggctcgagaccggctggggcctcaacgccgccacc
ggcgagtacgaggacctcatggccgcgggcatcaacgaccccgtcaaggtgacccgttcc
gcgctgcagaacgcggcgtcgatcgccgggctgttcctcaccacggaggccgtggtggcg
gacaagcccgagcccgaggccgccggtgcgggcgcgggtgccgatcccatgggtggcatg
ggcggcatgatgtga

DBGET integrated database retrieval system