KEGG   Kocuria rhizophila: KRH_18370Help
Entry
KRH_18370         CDS       T00701                                 

Gene name
groEL
Definition
chaperonin GroEL
Orthology
K04077  
chaperonin GroEL
Organism
krh  Kocuria rhizophila
Pathway
RNA degradation
Brite
KEGG Orthology (KO) [BR:krh00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    KRH_18370 (groEL)
Mitochondrial biogenesis [BR:krh03029]
 Mitochondrial protein import machinery
  Matrix
   Other matrix factors
    KRH_18370 (groEL)
Exosome [BR:krh04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   KRH_18370 (groEL)
  Exosomal proteins of other body fluids (saliva and urine)
   KRH_18370 (groEL)
  Exosomal proteins of breast cancer cells
   KRH_18370 (groEL)
  Exosomal proteins of colorectal cancer cells
   KRH_18370 (groEL)
  Exosomal proteins of bladder cancer cells
   KRH_18370 (groEL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(2089249..2090883)
Genome map
AA seq 544 aa AA seqDB search
MAKMIAFDEEARRGLEKGLNTLADAVKVTLGPRGRNVVLEKSWGAPTITNDGVSIAKEIE
LEEPYEKIGAELVKEVAKKTDDVAGDGTTTATVLAQALVKEGLRNVAAGADPLSLKRGIE
KAVASVTEQLLSSAKEIETEEEIAATASISAADPEIGKLIAEAMEKVGKEGVITVEESNT
FGLDLELTEGMRFDKGYLSGYFVTDADRQEAVLEDPYILIVNSKISAVKDLVPVLEKVMQ
AGKPLLIIAEDVDGEALAMLVLNKMRGAVKSVAVKAPGFGDRRKAQLADIAILTGGQVIT
EEVGLSLESATIDLLGQARKVVVTKDETTIVDGAGTQEEIEGRVAQIRAEINNSDSDYDR
EKLQERLAKLAGGVAVLKAGAATEVELKERKHRIEDAVRNAKAAVEEGIVAGGGVALIQA
GAKVFDSLNLSGDEATGANIVKVAIDAPLKQIALNAGMEPGVVVDKVRGLETGWGLNAAT
GEYEDLMAAGINDPVKVTRSALQNAASIAGLFLTTEAVVADKPEPEAAGAGAGADPMGGM
GGMM
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagatgatcgcattcgacgaagaagctcgccgcggcctcgagaagggtctgaac
accctcgcggacgccgtcaaggtcacgctcggcccgcgcggccgcaacgtggtcctggag
aagtcctggggcgctcccaccatcaccaacgacggcgtctccatcgccaaggagatcgag
ctcgaggagccgtacgagaagatcggcgccgagctcgtcaaggaggtcgccaagaagacc
gacgacgtcgccggtgacggcaccaccacggccaccgtgctcgcccaggccctcgtgaag
gaaggcctgcgcaacgtggccgccggtgcggacccgctgtccctcaagcgcggcatcgag
aaggccgtggcctccgtgaccgagcagctgctgtcctccgccaaggagatcgagaccgag
gaggagatcgccgccaccgcgtctatctccgccgcagaccccgagatcggcaagctcatc
gccgaggccatggagaaggtcggcaaggaaggcgtcatcaccgtcgaggagtccaacacc
ttcgggctggacctcgagctgaccgagggcatgcgcttcgacaagggctacctctccggc
tacttcgtcacggacgcggaccgccaggaggccgttctggaggatccctacatcctcatc
gtgaactccaagatctccgccgtgaaggacctggtccccgtgctggagaaggtcatgcag
gccggcaagccgctgctgatcatcgccgaggacgtggacggcgaggccctggccatgctg
gtgctgaacaagatgcgaggcgccgtgaagtccgtggccgtgaaggcccccggcttcggt
gaccgccgcaaggcccagctcgccgacatcgccatcctcaccggcggtcaggtcatcacc
gaagaggtcggcctgtccctcgagtccgccacgatcgacctgctgggccaggcccgcaag
gtcgtcgtcaccaaggacgagaccaccatcgtggacggcgccggcacccaggaggagatc
gagggccgcgtggcgcagatccgcgcggagatcaacaactccgactccgactacgaccgc
gagaagctgcaggagcgcctggccaagctggctggcggcgtggcagtgctcaaggccggt
gcggccaccgaggtggagctcaaggagcgcaagcaccgcatcgaggacgccgtgcgcaac
gccaaggcagccgtggaggagggcatcgtcgccggcggtggcgtggccctcatccaggcc
ggtgccaaggtcttcgactccctgaacctctcgggtgacgaggccaccggtgcgaacatc
gtcaaggtcgccatcgacgccccgctcaagcagatcgccctcaacgcgggcatggagccc
ggcgtggtggtcgacaaggtgcgcgggctcgagaccggctggggcctcaacgccgccacc
ggcgagtacgaggacctcatggccgcgggcatcaacgaccccgtcaaggtgacccgttcc
gcgctgcagaacgcggcgtcgatcgccgggctgttcctcaccacggaggccgtggtggcg
gacaagcccgagcccgaggccgccggtgcgggcgcgggtgccgatcccatgggtggcatg
ggcggcatgatgtga

DBGET integrated database retrieval system