KEGG   Kocuria rhizophila: KRH_18770Help
Entry
KRH_18770         CDS       T00701                                 

Gene name
gpmA
Definition
(GenBank) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
krh  Kocuria rhizophila
Pathway
krh00010  Glycolysis / Gluconeogenesis
krh00260  Glycine, serine and threonine metabolism
krh00680  Methane metabolism
krh01100  Metabolic pathways
krh01110  Biosynthesis of secondary metabolites
krh01120  Microbial metabolism in diverse environments
krh01130  Biosynthesis of antibiotics
krh01200  Carbon metabolism
krh01230  Biosynthesis of amino acids
Module
krh_M00002  Glycolysis, core module involving three-carbon compounds
krh_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:krh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KRH_18770 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    KRH_18770 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    KRH_18770 (gpmA)
Enzymes [BR:krh01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     KRH_18770 (gpmA)
Membrane trafficking [BR:krh04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    KRH_18770 (gpmA)
Exosome [BR:krh04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   KRH_18770 (gpmA)
  Exosomal proteins of melanoma cells
   KRH_18770 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: BAG30224
NITE: KRH_18770
UniProt: B2GG23
Position
complement(2151591..2152349)
Genome map
AA seq 252 aa AA seqDB search
MATDSATHKLILLRHGQSEWNEKNLFTGWVDVPLTDKGRAEATRGGELIAENQLLPDVVH
TSLLRRAMNTANLALDAADRLWIPVKRSWRLNERHYGALQGKNKAEIREEYGEEQFMTWR
RSYDTPPPALDDSSEWSQAGDPRYADVAELPRTECLKDVLERFMPYWDEQIVPDLKAGKT
VLVAAHGNSLRALVKHLDGISDEDIAGLNIPTGIPLYYELDQNLRPVTPGGRYLDPDAAA
ESIKAVAAQGKK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atggctaccgattcagcgacccacaagctcatcctcctgcgccacggccagtccgagtgg
aacgagaagaacctgttcaccggctgggtggacgttcccctcacggacaagggacgcgcg
gaggccacccgcggcggcgaactgatcgccgagaaccagctgctgccggacgtggtccac
acgtccctgctgcgccgcgccatgaacaccgccaacctggccctcgacgccgcggaccgg
ctctggatccccgtcaagcggtcctggcgtctcaacgaacgccactacggcgcgctgcag
ggcaagaacaaggccgagatccgcgaggagtacggcgaggagcagttcatgacctggcgc
cgctcttacgacaccccgccgcccgcgctcgacgactcctccgagtggtcccaggccggg
gacccccgctacgcggacgtggccgagctgccgcgcaccgagtgcctcaaggacgtcctg
gagcgcttcatgccttactgggacgagcagatcgtcccggacctcaaggccggcaagacc
gttctggtggccgcgcacggcaactcgctgcgcgccctggtcaagcacctggacgggatc
tccgacgaggacatcgccgggctcaacatccccacgggcatcccgctgtactacgagctg
gaccagaacctgcgtcccgtgaccccgggcggtcgctacctggacccggatgccgcggcc
gagtccatcaaagccgtggccgcgcagggcaagaagtag

DBGET integrated database retrieval system