KEGG   Kocuria rhizophila: KRH_18770Help
Entry
KRH_18770         CDS       T00701                                 

Gene name
gpmA
Definition
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
krh  Kocuria rhizophila
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:krh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KRH_18770 (gpmA)
   01230 Biosynthesis of amino acids
    KRH_18770 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KRH_18770 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    KRH_18770 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    KRH_18770 (gpmA)
Enzymes [BR:krh01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     KRH_18770 (gpmA)
Exosome [BR:krh04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   KRH_18770 (gpmA)
  Exosomal proteins of melanoma cells
   KRH_18770 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(2151591..2152349)
Genome map
AA seq 252 aa AA seqDB search
MATDSATHKLILLRHGQSEWNEKNLFTGWVDVPLTDKGRAEATRGGELIAENQLLPDVVH
TSLLRRAMNTANLALDAADRLWIPVKRSWRLNERHYGALQGKNKAEIREEYGEEQFMTWR
RSYDTPPPALDDSSEWSQAGDPRYADVAELPRTECLKDVLERFMPYWDEQIVPDLKAGKT
VLVAAHGNSLRALVKHLDGISDEDIAGLNIPTGIPLYYELDQNLRPVTPGGRYLDPDAAA
ESIKAVAAQGKK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atggctaccgattcagcgacccacaagctcatcctcctgcgccacggccagtccgagtgg
aacgagaagaacctgttcaccggctgggtggacgttcccctcacggacaagggacgcgcg
gaggccacccgcggcggcgaactgatcgccgagaaccagctgctgccggacgtggtccac
acgtccctgctgcgccgcgccatgaacaccgccaacctggccctcgacgccgcggaccgg
ctctggatccccgtcaagcggtcctggcgtctcaacgaacgccactacggcgcgctgcag
ggcaagaacaaggccgagatccgcgaggagtacggcgaggagcagttcatgacctggcgc
cgctcttacgacaccccgccgcccgcgctcgacgactcctccgagtggtcccaggccggg
gacccccgctacgcggacgtggccgagctgccgcgcaccgagtgcctcaaggacgtcctg
gagcgcttcatgccttactgggacgagcagatcgtcccggacctcaaggccggcaagacc
gttctggtggccgcgcacggcaactcgctgcgcgccctggtcaagcacctggacgggatc
tccgacgaggacatcgccgggctcaacatccccacgggcatcccgctgtactacgagctg
gaccagaacctgcgtcccgtgaccccgggcggtcgctacctggacccggatgccgcggcc
gagtccatcaaagccgtggccgcgcagggcaagaagtag

DBGET integrated database retrieval system