KEGG   Kocuria rhizophila: KRH_18910Help
Entry
KRH_18910         CDS       T00701                                 

Gene name
deoA
Definition
thymidine phosphorylase (EC:2.4.2.2)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
krh  Kocuria rhizophila
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:krh00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(2168793..2170088)
Genome map
AA seq 431 aa AA seqDB search
MVEAFDAVDVIRMKRDRGTLSPEAIDWVIDAYTRGVVADEQMSALAMAIFLNGMDRTEIS
RWTQAMIDSGERMNFKALSRPTADKHSTGGVGDKITLPLAPLVASFGVAVPQLSGRGLGH
TGGTLDKMEAIPGWRADLSNERMMEILDTVGAVICAAGSGLAPADKKLYALRDTTSTVEC
IPLIASSIMSKKIAEGTGALVLDVKTGPGAFMKSEQDARELARTMVDLGKDHGVDTVALL
TDMSRPLGRTVGNALEVRESVEVLAGGGPSDVVRLTVALAREMLAAAGVKDADVEAALQD
GRAMDAWKAMVAAQGGDPEAPLPEAKHTQDVLAETDGVLTEMDAMSVGVASWRLGAGRAR
QGDPVQAGAGVEIHAVPGERVTRGQKLFTLHTDTPERFERALESLSGGATIDPDAAEGTG
AREDVVIDRIA
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atggtcgaagcgttcgacgccgttgacgtcatccgcatgaagagggaccgcgggaccctg
tcccccgaggccatcgactgggtgatcgacgcctacacgcgcggcgtggtggcggacgag
cagatgtccgccctggccatggccatcttcctcaacgggatggaccgtaccgagatctcc
cgctggacgcaggccatgatcgactccggcgagcgcatgaacttcaaggccctctcccgg
cccaccgcggacaagcactccacgggtggcgtgggggacaagatcaccctcccgctcgcc
ccgctggtcgcgagcttcggggtggccgtgccgcagctctcgggccgcggcctgggccac
acgggcggcaccctggacaagatggaggccatcccggggtggcgcgcggacctttccaac
gagcgcatgatggagatcctggacaccgtgggtgcggtgatctgcgccgcgggcagcggc
ctggcaccggcggacaagaagctctacgcgctgcgtgacaccacctccacggtcgagtgc
atcccgctgatcgcgtcctccatcatgtccaagaagatcgccgagggcaccggcgccctg
gtgctggacgtcaagaccggcccgggcgcgttcatgaagtccgagcaggacgcccgggag
ctcgcgcgcaccatggtggacctcggcaaggaccacggggtggacaccgtcgcgctgctc
acggacatgtcccgcccgctcgggcgcaccgtgggcaacgccctggaggtgcgcgagtcg
gtggaggtgctcgccgggggcgggccgagcgacgtcgtgcgcctgaccgtggcgctcgcg
cgggagatgctcgccgcggccggtgtgaaggatgcggacgtcgaggccgcgctgcaggac
gggcgcgccatggacgcctggaaggccatggtggccgcgcagggcggtgaccccgaggcc
ccgctgccggaggcgaagcacacgcaggacgtgctggccgagacggacggcgtgctcacc
gagatggacgcgatgtccgtgggtgtggcgtcgtggcgcctcggtgccggccgtgcccgg
cagggcgatcccgtgcaggccggcgccggtgtggagatccacgcggtgcccggtgagcgc
gtcaccagggggcagaagctgttcaccctgcacacggacacccccgagcgcttcgagcgc
gccctggagtccctgtccgggggcgccaccatcgatcccgacgccgcggagggcaccggc
gcccgcgaggacgtggtgatcgaccggatcgcctga

DBGET integrated database retrieval system