KEGG   Kocuria rhizophila: KRH_19780Help
Entry
KRH_19780         CDS       T00701                                 

Definition
putative uricase (EC:1.7.3.3)
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
krh  Kocuria rhizophila
Pathway
Purine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:krh00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    KRH_19780
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    KRH_19780
Enzymes [BR:krh01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     KRH_19780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
2273841..2274725
Genome map
AA seq 294 aa AA seqDB search
MTDVVLGKNQYGKAENHVVRIHRDTDRHVIRDLVVTSQLRGDFEAVHTQGDNAHCVPTDT
QKNTVFAFVQKYGVDSPEALLLKLSEHFTSEFEWVSGGRWAADEHAWDRINDNDHCFVQN
KQEVRTAVVVTDGPRSTVISGFKDLTVLKSTESGFQGYPKDQYTTLPETTDRIMSTDVAT
RWRYSTTDVDFDAVYEDVKKIILDKFTDHYSRALQETLYLMGKAVIEAHPEIDEIKFSCP
NKHHFVYDLGFCDLPNDNETHYAADRPFGLIEATVQRKDAQPDENAWVGIAGFC
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgtagtgctcgggaagaaccagtacggcaaggccgagaaccacgtggtgcgc
atccaccgcgacaccgaccgccacgtgatccgggacctggtggtcacgtcccagctgcgc
ggcgacttcgaggccgtgcacacccagggggacaacgcgcactgtgtgcccacggacacc
cagaagaacaccgtgttcgcgttcgtccagaagtacggggtggactcccccgaggcgctg
ctgctcaagctctcggagcacttcacctccgagttcgagtgggtctccggcggccggtgg
gccgcggacgagcacgcgtgggaccgcatcaacgacaacgaccactgcttcgtgcagaac
aagcaggaggtccgcaccgccgtggtggtcacggacggcccgaggagcaccgtgatctcc
ggcttcaaggacctcacggtcctgaagtccacggagtccgggttccagggctaccccaag
gaccagtacaccaccctgccggagaccacggaccggatcatgtccacggacgtggccacc
cggtggcgctacagcaccacggacgtggacttcgacgccgtgtacgaggacgtcaagaag
atcatcctggacaagttcacggaccactactcccgggccctgcaggagacgctctacctc
atgggcaaggccgtgatcgaggcgcacccggagatcgacgagatcaagttctcgtgcccc
aacaagcaccacttcgtctacgacctggggttctgcgacctgccgaacgacaacgagacc
cactacgcggcggaccgcccgttcgggctgatcgaggccacggtgcagcgcaaggacgcc
cagccggacgagaacgcctgggtgggcatcgccggcttctgctga

  All links  
No link information was found.   
DBGET integrated database retrieval system