KEGG   Kocuria rhizophila: KRH_19810Help
Entry
KRH_19810         CDS       T00701                                 

Gene name
aceB
Definition
(RefSeq) malate synthase (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
krh  Kocuria rhizophila
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:krh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KRH_19810 (aceB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    KRH_19810 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    KRH_19810 (aceB)
Enzymes [BR:krh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     KRH_19810 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
2277554..2279161
Genome map
AA seq 535 aa AA seqDB search
MSITHTTPQNVAAADEILSEEALAFVEALHEKFADRREELLDQRETARAKAAETGTMDFL
PETREVREGDWKVAPAPEALQDRRVEMTGPASPAKMAINALNSGAKVWLADLEDAASPSW
ANQVDAIANLRDAARGTLGFTSPEGKEYKLREDVPLAVVVMRPRGWHLPEYNITVNGKTG
SGSLTDFGLHFFHTAKQLLENGQGPYYYLPKMESYLEARLWNDVFTFAEEYLGIEHGTVR
ATVLIETIPAAFQMDEILYELRDHASGLNAGRWDYLFSIIKYFRDAGEKFILADRSAVTM
TAPLMRAYTDLLVQTCHKRGAFAMGGMAAFIPSRKDEEINKAAFEKVRNDKTREAGDGFD
GSWVAHPDLVPVCQEVFDGVLGENPNQVDHQRPDVDVTAEMLLDVPSAGDQRTEKELNAN
LYVAIRYVAVWLSGNGAVAIHNLMEDAATAEISRSQIWQQIKNGVVYTDTGNTATRELVA
DALDTQLDVLRGEIDEENFEKWFVPAGRLIADMVLKEDYPAFLTLSAYDLMEGSK
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgagcatcacccacaccaccccgcagaacgtggccgcggcggacgagatcctctcggag
gaggccctcgcgttcgtcgaggcgctgcacgagaagttcgcggaccgccgtgaggagctg
ctcgaccagcgcgagaccgcccgtgctaaggccgcagagaccggcaccatggacttcctc
cccgagacccgcgaggtccgggagggcgactggaaggtcgccccggcgcccgaggcgctg
caggaccggcgcgtggagatgaccgggccggcgtcgcccgccaagatggccatcaacgcg
ctgaactccggcgccaaggtgtggctcgcggacctcgaggacgccgcctcccccagctgg
gccaaccaggtggacgcgatcgccaacctgcgcgacgccgcccgcggcaccctgggcttc
acctccccggagggcaaggagtacaagctgcgcgaggacgtgccgctggccgtggtggtc
atgcgtccgcgcggctggcacctgcccgagtacaacatcacggtcaacggcaagaccggc
tccggctccctcacagacttcgggctgcacttcttccacacggcgaagcagctgctcgag
aacggccagggcccgtactactacctgcccaagatggagtcctacctggaggcgcggctg
tggaacgacgtgttcacgttcgcggaggagtacctgggcatcgagcacggcaccgtccgt
gcgaccgtgctgatcgagaccatccccgccgcgttccagatggacgagatcctctacgag
ctgcgggaccacgcctccgggctcaacgccgggcgctgggactacctgttctccatcatc
aagtacttccgcgacgccggggagaagttcatcctggcggaccgctccgccgtgaccatg
accgctcccctgatgcgcgcctacacggacctgctggtgcagacgtgccacaagcgcggt
gccttcgcgatgggcggcatggccgcgttcatcccctcccgcaaggacgaggagatcaac
aaggccgcgttcgagaaggtccgcaacgacaagacccgtgaggccggggacggcttcgac
ggttcgtgggtggcccacccggacctggtgcccgtgtgccaggaggtcttcgacggcgtg
ctcggggagaaccccaaccaggtggaccaccagcgcccggacgtggacgtgaccgccgag
atgctgctggatgtgccctccgcgggtgaccagcgcaccgagaaggagctcaacgccaac
ctgtacgtggccatccgctacgtggccgtgtggctctcgggcaacggcgcggtggccatc
cacaacctcatggaggacgccgctaccgcggagatctcccgctcgcagatctggcagcag
atcaagaacggtgtggtctacacggacaccggcaacaccgccacgcgcgagctggtcgcc
gacgccctggacacccagctcgacgtgctgcgcggggagatcgacgaggagaacttcgag
aagtggttcgtgcccgccggccggctgatcgcggacatggtgctcaaggaggactacccg
gcgttcctcacgctgtccgcctacgacctcatggaaggcagcaagtga

DBGET integrated database retrieval system