KEGG   Kocuria rhizophila: KRH_19810Help
Entry
KRH_19810         CDS       T00701                                 

Gene name
glcB
Definition
(GenBank) malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
krh  Kocuria rhizophila
Pathway
krh00620  Pyruvate metabolism
krh00630  Glyoxylate and dicarboxylate metabolism
krh01100  Metabolic pathways
krh01110  Biosynthesis of secondary metabolites
krh01120  Microbial metabolism in diverse environments
krh01200  Carbon metabolism
Module
krh_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:krh00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    KRH_19810 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    KRH_19810 (glcB)
Enzymes [BR:krh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     KRH_19810 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI GFO_IDH_MocA_C
Motif
Other DBs
NCBI-ProteinID: BAG30328
NITE: KRH_19810
UniProt: B2GGL2
Position
2277554..2279161
Genome map
AA seq 535 aa AA seqDB search
MSITHTTPQNVAAADEILSEEALAFVEALHEKFADRREELLDQRETARAKAAETGTMDFL
PETREVREGDWKVAPAPEALQDRRVEMTGPASPAKMAINALNSGAKVWLADLEDAASPSW
ANQVDAIANLRDAARGTLGFTSPEGKEYKLREDVPLAVVVMRPRGWHLPEYNITVNGKTG
SGSLTDFGLHFFHTAKQLLENGQGPYYYLPKMESYLEARLWNDVFTFAEEYLGIEHGTVR
ATVLIETIPAAFQMDEILYELRDHASGLNAGRWDYLFSIIKYFRDAGEKFILADRSAVTM
TAPLMRAYTDLLVQTCHKRGAFAMGGMAAFIPSRKDEEINKAAFEKVRNDKTREAGDGFD
GSWVAHPDLVPVCQEVFDGVLGENPNQVDHQRPDVDVTAEMLLDVPSAGDQRTEKELNAN
LYVAIRYVAVWLSGNGAVAIHNLMEDAATAEISRSQIWQQIKNGVVYTDTGNTATRELVA
DALDTQLDVLRGEIDEENFEKWFVPAGRLIADMVLKEDYPAFLTLSAYDLMEGSK
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgagcatcacccacaccaccccgcagaacgtggccgcggcggacgagatcctctcggag
gaggccctcgcgttcgtcgaggcgctgcacgagaagttcgcggaccgccgtgaggagctg
ctcgaccagcgcgagaccgcccgtgctaaggccgcagagaccggcaccatggacttcctc
cccgagacccgcgaggtccgggagggcgactggaaggtcgccccggcgcccgaggcgctg
caggaccggcgcgtggagatgaccgggccggcgtcgcccgccaagatggccatcaacgcg
ctgaactccggcgccaaggtgtggctcgcggacctcgaggacgccgcctcccccagctgg
gccaaccaggtggacgcgatcgccaacctgcgcgacgccgcccgcggcaccctgggcttc
acctccccggagggcaaggagtacaagctgcgcgaggacgtgccgctggccgtggtggtc
atgcgtccgcgcggctggcacctgcccgagtacaacatcacggtcaacggcaagaccggc
tccggctccctcacagacttcgggctgcacttcttccacacggcgaagcagctgctcgag
aacggccagggcccgtactactacctgcccaagatggagtcctacctggaggcgcggctg
tggaacgacgtgttcacgttcgcggaggagtacctgggcatcgagcacggcaccgtccgt
gcgaccgtgctgatcgagaccatccccgccgcgttccagatggacgagatcctctacgag
ctgcgggaccacgcctccgggctcaacgccgggcgctgggactacctgttctccatcatc
aagtacttccgcgacgccggggagaagttcatcctggcggaccgctccgccgtgaccatg
accgctcccctgatgcgcgcctacacggacctgctggtgcagacgtgccacaagcgcggt
gccttcgcgatgggcggcatggccgcgttcatcccctcccgcaaggacgaggagatcaac
aaggccgcgttcgagaaggtccgcaacgacaagacccgtgaggccggggacggcttcgac
ggttcgtgggtggcccacccggacctggtgcccgtgtgccaggaggtcttcgacggcgtg
ctcggggagaaccccaaccaggtggaccaccagcgcccggacgtggacgtgaccgccgag
atgctgctggatgtgccctccgcgggtgaccagcgcaccgagaaggagctcaacgccaac
ctgtacgtggccatccgctacgtggccgtgtggctctcgggcaacggcgcggtggccatc
cacaacctcatggaggacgccgctaccgcggagatctcccgctcgcagatctggcagcag
atcaagaacggtgtggtctacacggacaccggcaacaccgccacgcgcgagctggtcgcc
gacgccctggacacccagctcgacgtgctgcgcggggagatcgacgaggagaacttcgag
aagtggttcgtgcccgccggccggctgatcgcggacatggtgctcaaggaggactacccg
gcgttcctcacgctgtccgcctacgacctcatggaaggcagcaagtga

DBGET integrated database retrieval system