KEGG   Kocuria rhizophila: KRH_21270Help
Entry
KRH_21270         CDS       T00701                                 

Definition
(GenBank) dihydrolipoamide acyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
krh  Kocuria rhizophila
Pathway
krh00010  Glycolysis / Gluconeogenesis
krh00020  Citrate cycle (TCA cycle)
krh00620  Pyruvate metabolism
krh01100  Metabolic pathways
krh01110  Biosynthesis of secondary metabolites
krh01120  Microbial metabolism in diverse environments
krh01130  Biosynthesis of antibiotics
krh01200  Carbon metabolism
Module
krh_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:krh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KRH_21270
   00020 Citrate cycle (TCA cycle)
    KRH_21270
   00620 Pyruvate metabolism
    KRH_21270
Enzymes [BR:krh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     KRH_21270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Motif
Other DBs
NCBI-ProteinID: BAG30474
NITE: KRH_21270
UniProt: B2GHW2
Position
2446353..2447897
Genome map
AA seq 514 aa AA seqDB search
MSINVFNLPDLGEGLTEADILRWLVAEGDTVTMDQPIVEVETAKSAVEVPTPFEGVVHKL
HGAEGDTMLVDQPLISISDGVESPEAPAGSETDADAPGAEHGASYREEELAGTTPSAELS
VDEADPTAGEDEESSGNVLIGYGTSAASSSRRRRRKRGAGADAAGQTHDALAEAPRLAPT
VISPLVRKLAREHGVDIAALQGTGPGGLIMRKDVLAAIDQVDDQRMRADAAGPAPTGLSA
AEPAAPAPAGLSAAGGAAPQGGAAAASSPAAAGPDSRTGLPIALQEPVKGVRKTIADAMT
RSRTEIPEATVWVDVDATELLKLRSELKAKDPENTPSLLALIARFTVAGLRKFPQLNARV
DTAEDGSRTITRLQGVNLGLAVESERGLMVPNLRNADQLSAMELTGAMREIIQVARSGKA
SPAQLSGSTFTLNNYGVFGTDGATPIINHPEAAILGIGRIIDKPWVVDGELAVRKVTTVT
IAFDHRVCDGGAAGGFIRFVADCIENPVGALTQI
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
gtgagcatcaatgtgttcaacctgcccgacctgggcgaagggctcaccgaggcggacatc
ctccgctggctcgtggccgagggtgacaccgtcaccatggaccagcccatcgtggaagtg
gagaccgccaagtccgccgtggaggtgcccaccccgttcgagggcgtggtccacaagctg
cacggcgcggagggggacaccatgctggtggaccagccgctgatctccatctccgacggc
gtggagtcccccgaggcccccgccggctccgagacggacgcggacgcgcccggcgccgag
cacggcgcgagctaccgcgaggaggagctcgcgggcaccacgccctcggccgagctgtcc
gtggacgaagccgatcccaccgcaggtgaggacgaggagtcctccggcaacgtgctgatc
ggctacggcacctccgccgcgtcctcgtcccgccgacgccgccgcaagcgcggtgccggt
gccgacgccgccgggcagacccacgacgcgctcgccgaggccccgcgcctggcccccacc
gtgatctccccgctcgtgcgcaagctcgcccgggagcacggcgtggacatcgccgccctc
cagggcaccggccccggcggtctgatcatgcgcaaggacgtcctcgcggccatcgaccag
gtggacgaccagcggatgcgcgccgacgccgccgggccggcccccacgggcctctccgcc
gcggagcccgcggctcccgcccccgccggcctgagcgccgcgggaggtgcggcaccccag
ggtggtgccgcggcggcgtcgtccccggcggccgccgggcccgactcccgcaccgggctg
ccgatcgcgttgcaggagcccgtcaagggcgtgcgcaagaccattgcggacgccatgacc
cgctcccgcacggagatcccggaggccaccgtgtgggtggacgtggacgccaccgagctg
ctgaagctgcgctccgagctcaaggccaaggatccggagaacacgccgagcctgctcgcg
ctgatcgcccggttcaccgtggccgggctgcggaagttcccgcagctcaacgcccgcgtg
gacaccgccgaggacggctcccggaccatcacccgcctgcagggcgtgaacctgggcctc
gcggtggagtccgagcgcggactcatggtgccgaacctgcgcaacgcggatcagctcagc
gccatggagctgaccggcgccatgcgggagatcatccaggtggctcgctccggcaaggcc
agccccgcccagctgagcggctccacgttcacgctgaacaactacggcgtgttcggcaca
gacggcgccaccccgatcatcaaccaccccgaggccgcgatcctgggcatcgggcggatc
atcgacaagccgtgggtggtggacggtgagctggccgtccgcaaggtcaccaccgtgacc
atcgccttcgaccaccgggtgtgcgacggcggcgcggccggcggcttcatccgcttcgtg
gcggactgcatcgagaaccccgtgggggcgctcacgcagatctga

DBGET integrated database retrieval system