KEGG   Kocuria rhizophila: KRH_21270Help
Entry
KRH_21270         CDS       T00701                                 

Definition
branched-chain alpha-keto acid dehydrogenase subunit E2 (EC:2.3.1.-)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
krh  Kocuria rhizophila
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:krh01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:krh00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:krh00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:krh00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
2446353..2447897
Genome map
AA seq 514 aa AA seqDB search
MSINVFNLPDLGEGLTEADILRWLVAEGDTVTMDQPIVEVETAKSAVEVPTPFEGVVHKL
HGAEGDTMLVDQPLISISDGVESPEAPAGSETDADAPGAEHGASYREEELAGTTPSAELS
VDEADPTAGEDEESSGNVLIGYGTSAASSSRRRRRKRGAGADAAGQTHDALAEAPRLAPT
VISPLVRKLAREHGVDIAALQGTGPGGLIMRKDVLAAIDQVDDQRMRADAAGPAPTGLSA
AEPAAPAPAGLSAAGGAAPQGGAAAASSPAAAGPDSRTGLPIALQEPVKGVRKTIADAMT
RSRTEIPEATVWVDVDATELLKLRSELKAKDPENTPSLLALIARFTVAGLRKFPQLNARV
DTAEDGSRTITRLQGVNLGLAVESERGLMVPNLRNADQLSAMELTGAMREIIQVARSGKA
SPAQLSGSTFTLNNYGVFGTDGATPIINHPEAAILGIGRIIDKPWVVDGELAVRKVTTVT
IAFDHRVCDGGAAGGFIRFVADCIENPVGALTQI
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
gtgagcatcaatgtgttcaacctgcccgacctgggcgaagggctcaccgaggcggacatc
ctccgctggctcgtggccgagggtgacaccgtcaccatggaccagcccatcgtggaagtg
gagaccgccaagtccgccgtggaggtgcccaccccgttcgagggcgtggtccacaagctg
cacggcgcggagggggacaccatgctggtggaccagccgctgatctccatctccgacggc
gtggagtcccccgaggcccccgccggctccgagacggacgcggacgcgcccggcgccgag
cacggcgcgagctaccgcgaggaggagctcgcgggcaccacgccctcggccgagctgtcc
gtggacgaagccgatcccaccgcaggtgaggacgaggagtcctccggcaacgtgctgatc
ggctacggcacctccgccgcgtcctcgtcccgccgacgccgccgcaagcgcggtgccggt
gccgacgccgccgggcagacccacgacgcgctcgccgaggccccgcgcctggcccccacc
gtgatctccccgctcgtgcgcaagctcgcccgggagcacggcgtggacatcgccgccctc
cagggcaccggccccggcggtctgatcatgcgcaaggacgtcctcgcggccatcgaccag
gtggacgaccagcggatgcgcgccgacgccgccgggccggcccccacgggcctctccgcc
gcggagcccgcggctcccgcccccgccggcctgagcgccgcgggaggtgcggcaccccag
ggtggtgccgcggcggcgtcgtccccggcggccgccgggcccgactcccgcaccgggctg
ccgatcgcgttgcaggagcccgtcaagggcgtgcgcaagaccattgcggacgccatgacc
cgctcccgcacggagatcccggaggccaccgtgtgggtggacgtggacgccaccgagctg
ctgaagctgcgctccgagctcaaggccaaggatccggagaacacgccgagcctgctcgcg
ctgatcgcccggttcaccgtggccgggctgcggaagttcccgcagctcaacgcccgcgtg
gacaccgccgaggacggctcccggaccatcacccgcctgcagggcgtgaacctgggcctc
gcggtggagtccgagcgcggactcatggtgccgaacctgcgcaacgcggatcagctcagc
gccatggagctgaccggcgccatgcgggagatcatccaggtggctcgctccggcaaggcc
agccccgcccagctgagcggctccacgttcacgctgaacaactacggcgtgttcggcaca
gacggcgccaccccgatcatcaaccaccccgaggccgcgatcctgggcatcgggcggatc
atcgacaagccgtgggtggtggacggtgagctggccgtccgcaaggtcaccaccgtgacc
atcgccttcgaccaccgggtgtgcgacggcggcgcggccggcggcttcatccgcttcgtg
gcggactgcatcgagaaccccgtgggggcgctcacgcagatctga

DBGET integrated database retrieval system