KEGG   Kocuria rhizophila: KRH_21350Help
Entry
KRH_21350         CDS       T00701                                 

Gene name
speB
Definition
putative agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
krh  Kocuria rhizophila
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:krh00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    KRH_21350 (speB)
Enzymes [BR:krh01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     KRH_21350 (speB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(2454207..2455244)
Genome map
AA seq 345 aa AA seqDB search
MEPERIVETNSAGEQRVGPVNAALTPRWAGPATFARLPRTDQVEHTDVAVVGVPFDSGVS
YRSGARFGPNHVRESSRLLRPYNPAQNHSPFANLQVADAGDIVGNPFDIPEAIDSIETAA
KELMGESTKVVAIGGDHTIALPLLRAAHSRHGKVALLHFDAHLDTWDTYFGAEYTHGTPF
RRAFEEGIIDTDAVMHVGTRGPLYGTQDLEDDARFGFEIVSSADVMRSGVDAVVAALRER
VGDRPLYISLDIDVLDPAHAPGTGTPEAGGITSREVLEILRGLRGLDVVACDVVEVSPAY
DHAELTGIAAAHVVYELISLISLGADAAADGPAYGISGARYGSEQ
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
gtggaaccggaacgcatcgtcgagaccaacagcgctggtgagcagcgggtggggcccgtg
aacgcggccctcactccgcgctgggccgggcccgccacgttcgcgcggctgccccgcact
gaccaggtggagcacacggacgtggccgtggtgggcgtgcccttcgactccggggtgtcc
taccgctccggggcacgcttcgggccgaaccacgtccgcgagtcctcccgcctgctgcgc
ccctacaacccggcgcagaaccactcgccgttcgccaacctgcaggtcgcggacgccggg
gacatcgtgggcaacccgttcgacatccccgaggccatcgactccatcgagaccgcggcc
aaggagctcatgggggagtccaccaaggtggtggcgatcggcggtgaccacaccatcgcc
ctgcccctgctgcgcgcggcgcactcgcgccacggcaaggtggcgctgctgcacttcgac
gcccacctggacacgtgggacacctacttcggcgccgagtacacccacggcaccccgttc
cgccgggcgttcgaggaggggatcatcgacaccgacgccgtgatgcacgtgggcacccgc
ggtccgctctacggcacgcaggacctcgaggacgacgcccgcttcggtttcgagatcgtc
tcctccgcggacgtcatgcgctccggcgtggacgccgtggtcgcggccctgcgcgagcgc
gtgggggaccgcccgctctacatctccctggacatcgacgtcctggaccccgcccacgcc
cccggcaccggaacccccgaggccggcggcatcacgagccgcgaggtcctggagatcctg
cgcggactgcgcgggctggacgtggtcgcatgcgacgtcgtggaggtctccccggcgtac
gaccacgccgagctcaccggcatcgccgccgcgcacgtggtctacgagctgatctccctg
atcagcctgggggccgacgccgccgcggacggtcccgcgtacggcatctccggcgcgcgc
tacggatcggagcagtga

DBGET integrated database retrieval system