KEGG   Kytococcus sedentarius: Ksed_00310Help
Entry
Ksed_00310        CDS       T00974                                 

Definition
glutaminase
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
kse  Kytococcus sedentarius
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kse00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Ksed_00310
   00330 Arginine and proline metabolism
    Ksed_00310
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Ksed_00310
Enzymes [BR:kse01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     Ksed_00310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(33631..35568)
Genome map
AA seq 645 aa AA seqDB search
MPPVNHANPANPLSDLLARVHDRFRTHDEGEVAGYVESTGGVDTRDFGLAITTVDGHTYS
HGEADRLFAIQSISKAFTYAVALTDAGFDAVDAVIDVEPSGEAFNEISLQEDTGRPSNAL
INAGAIASTSLVSGSSSNPYAGTRGTQPDDGAHQSPEGSRRERLVRAFSAMAGRDLTVNE
RVLDFEREDGDRNLALAHLMRSFDLISEGPEEIADDYFATCAIEVTTEDLSMMAALLATG
GIHPVSGERLLSEDVVERVLGVMSTCGMYDDAGEWMVRVGLPAKSGVGGGIVAVVPGQAG
VAVYSPPLDRHGNSERGVLACEALSQELDLHLMHGARVTHSAVRVTYPVTAAPSGVRRRP
AAEAVLADHGHRGRVIEVQGDLTFGAAESVMRELVGLDEVDGVVVDVRRVTEVTDFARAG
LTELATGFDHQGTVMVLVDDSGRVADADRVRVVSRRKDAIELVEELLLERHGGDELDRSE
VEVQDAGVMATLDDADTEALLARMEARQYAAGEVVITEGARFAGIHLITSGTVETTAREP
GAESRDEEDPTDPRADDDVEFRRLSVLGPGHSFGEFGLLADGRHATTVTAREELHTWVLT
PQVLTRLETEDPSLALRLWQAISRDAYTRIRSQMDEIAARGADRR
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgcccccggtgaaccatgcgaaccccgcgaacccactgtccgacctgctcgcgcgggta
cacgaccgattccgcacccacgacgagggcgaggtggccgggtacgtcgagtccaccggc
ggggtcgacacccgggacttcggcctggccatcaccaccgtcgacggccacacctactcc
cacggcgaggccgaccgcctcttcgccatccagtccatctccaaggcgttcacctacgcc
gtggccctgaccgatgcggggttcgatgccgtggacgccgtgatcgacgtggagccctcc
ggggaggcgttcaacgagatctcgctgcaggaggacaccggccggccctcgaacgcgctg
atcaacgctggcgccatcgcgtcgacctcgctggtgtccggcagctcgagcaacccctac
gccggcacccggggcacccaacccgatgacggggcgcaccagagccccgaggggtcgcgc
cgcgagcggctggtgcgggccttctccgcgatggcggggcgtgacctcaccgtcaacgag
cgggtgctggacttcgagcgggaggacggcgaccgcaacctggccctggcccacctgatg
cggagcttcgacctcatcagcgaggggcccgaggagatcgccgacgactacttcgccacc
tgcgccatcgaggtgaccaccgaggacctgtcgatgatggcggcgctcctggccaccggc
ggcatccacccggtcagcggcgagcgcctgctcagcgaggacgtcgtcgagcgcgtgctg
ggggtcatgagcacctgcggcatgtacgacgacgccggggagtggatggtgcgcgtgggc
ctgccggccaagtccggcgtcggcggcgggatcgtggcggtggtgcccgggcaggccggg
gtggccgtctactcgccgccgctggaccgccacggcaactccgagcggggcgtgctggcg
tgcgaggccctctcgcaggagttggacctgcacctcatgcacggtgcacgcgtcacccac
tccgcggtccgcgtgacctacccggtgaccgccgcccccagcggggtgcgtcgccggccg
gccgccgaggccgtgttggccgaccacggtcaccgcgggcgcgtcatcgaggtgcagggg
gacctgaccttcggcgccgcggagtccgtgatgcgggagctcgtcgggctggacgaggtg
gacggggtggtggtggacgtccggcgcgtcacggaggtgaccgacttcgcccgggccggc
ctcaccgagctcgcgacgggattcgaccaccagggcacggtgatggtgctggtggacgac
tccggccgggtggccgacgccgaccgggtgcgcgtcgtctcccgccgcaaggacgccatc
gagctggtcgaggagctgctgctggagcgccacggcggggacgagctcgaccgctccgag
gtggaggtgcaggacgccggggtgatggccacgctggacgacgccgacaccgaggccctc
ttggcgcggatggaggcccggcagtacgccgccggggaggtcgtgatcaccgagggtgcg
cgcttcgcggggatccacctcatcaccagcggcacggtggagacgacggcccgcgagccc
ggggccgagtcgcgcgacgaggaggaccccaccgacccgcgggccgacgacgacgtggag
ttccggcgcctgtcggtgctcggaccggggcacagcttcggcgagttcgggctgctggcg
gacgggcgccacgccacgacggtgacggcccgggaggagctgcacacctgggtgctgacc
ccccaggtgctcacccggctggagaccgaggatccgtccctggcactgcgactgtggcag
gccatcagccgcgatgcgtacacccgcatccgctcgcagatggacgagatcgccgccagg
ggggccgacagacggtag

DBGET integrated database retrieval system