KEGG   Kytococcus sedentarius: Ksed_01080Help
Entry
Ksed_01080        CDS       T00974                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
kse  Kytococcus sedentarius
Pathway
kse00010  Glycolysis / Gluconeogenesis
kse00620  Pyruvate metabolism
kse00640  Propanoate metabolism
kse00680  Methane metabolism
kse01100  Metabolic pathways
kse01110  Biosynthesis of secondary metabolites
kse01120  Microbial metabolism in diverse environments
kse01130  Biosynthesis of antibiotics
kse01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:kse00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ksed_01080
   00620 Pyruvate metabolism
    Ksed_01080
   00640 Propanoate metabolism
    Ksed_01080
  Energy metabolism
   00680 Methane metabolism
    Ksed_01080
Enzymes [BR:kse01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Ksed_01080
Lipid biosynthesis proteins [BR:kse01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Ksed_01080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ACV05200
UniProt: C7NIX5
Position
112374..114326
Genome map
AA seq 650 aa AA seqDB search
MTPENDAAAVRTYPPAAEFAAQANATAELAERAGADREAFWAEQSRELLPWATDFSEVLD
WSEAPFARWFADGEINASYACLDQHVEAGRGDEVAIHWVGEPEGDRRDLTWSDLLEETCR
AANVLEDLGVQAGDRVAIYLPMIPETVVAMLACARIGATHSVIFGGFAPNAIRARVQDAE
AKVVITADGGYRKGKASALKANVDEALSHEDTTVSTVLVVRRTGQDVGWQDGRDQWWHEA
METASSDHEAQPMPAEHPLFILYTSGTTGTPKGIFHTTGGYLTQTAYTAKMVLDLEPGRD
VYWCTADVGWVTGHSYLVYGPMALGVTQVMYEGTPDTPHKGRWWEIVQEYGVTVLYTAPT
AIRAAMKWGDDIPAQYDLSSLRLLGSVGEPINPEAWAWYREHIGGGRTPIVDTWWQTETG
AMMIAPLPGVTELVPGSAQTPVPGITVDVVGESGQSVGNGESGYLVIRDPWPAMLRGVWG
DPQRFRDTYWSRFEGMYFAGDGAKRDEDGNVWVLGRVDDVMNVSGHRLSTSEIESALVSH
DAVAEAAVVGATDASTGQAVVAYVILRGDAAEARGEGDDDAELVAELRAHVGKEIGPIAR
PRDITVVPELPKTRSGKIMRRLLRDLAEGKEVGDVSTLADPSVMDSIRRP
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atgacccccgagaacgacgctgctgccgtccgcacctacccgccggcggccgagttcgcc
gcacaggccaacgcgacggccgagctggccgagcgcgccggcgcggaccgcgaggcgttc
tgggcggagcagtcccgcgagctcctgccgtgggccacggacttctccgaggtgctggac
tggtccgaggcccccttcgcccgctggttcgccgacggggagatcaacgcctcctacgcc
tgcctcgaccagcacgtcgaggccggccgtggcgacgaggtcgccatccactgggtgggt
gagccggagggcgaccgccgcgacctgacctggagcgacctgctcgaggagacctgccgc
gcggccaacgtactggaggacttgggcgtccaggccggggaccgggtggcgatctacctg
ccgatgatccccgagacggtcgtggcgatgcttgcgtgcgcccgcatcggcgccacccac
tcggtcatcttcggcgggttcgcgcccaacgccatccgggcccgcgtgcaggacgccgag
gccaaggtggtcatcaccgccgacggcggctaccgcaagggcaaggcgagcgccctgaaa
gccaacgtggacgaggccctcagccacgaggacaccaccgtgtccacggtgctggtggtg
cgccgcaccggccaggacgtgggctggcaggacggccgcgaccagtggtggcacgaggcc
atggagacggcctcgtcggaccacgaggcccagccgatgccggccgagcacccgttgttc
atcctctacacctccggcaccacggggacacccaagggcatcttccacaccaccggcggg
tacctgacgcagacggcgtacacggccaagatggtgcttgacctggagcccggccgggac
gtgtactggtgcaccgccgacgtcggctgggtcaccgggcactcctacctcgtctacggc
ccgatggcgctgggcgtcacccaggtgatgtacgagggcacgcctgacaccccccacaag
ggccggtggtgggagatcgtccaggagtacggcgtcaccgtcctctacacggctcccacc
gccatccgcgcggcgatgaagtggggcgacgacatccccgcgcagtacgacctctcctcg
ctgcgcctgctgggtagcgtgggtgagcccatcaaccccgaggcctgggcctggtaccgg
gagcacatcggtggcgggcgcacccccatcgtggacacgtggtggcagaccgagacgggc
gcgatgatgatcgcccccctgccgggcgtgaccgagctggtgcccgggtccgcgcagacg
ccggtgcccggcatcacggtggacgtggtgggcgagtccggccagtcggtgggcaacggg
gagagcggctacctggtgatccgggacccgtggccggccatgctgcgcggcgtctggggc
gatccgcagcgcttccgcgacacgtactggtcgcgcttcgagggcatgtacttcgccggg
gacggggccaagcgggacgaggacggcaacgtctgggtgctgggccgcgtggacgacgtc
atgaacgtctccgggcaccgcctgagcacctcggagatcgagtccgccctggtcagccac
gatgcggtcgccgaggccgcggtggtcggcgcgaccgacgcctccaccggccaggcggtg
gtggcctacgtgatcctgcgcggggacgccgccgaggcgcgcggtgagggcgatgacgac
gccgagctggtggccgagctgcgggcccacgtgggcaaggagatcggcccgatcgcgcgc
ccgcgcgacatcaccgtggtaccggagctgccgaagacgcggtctggcaagatcatgcgt
cgactgctgcgggacctcgccgagggcaaggaggtcggtgacgtctcgacgctggccgac
ccctcggtgatggactccatccgtcgtccctga

DBGET integrated database retrieval system