KEGG   Kytococcus sedentarius: Ksed_02820Help
Entry
Ksed_02820        CDS       T00974                                 

Definition
phosphoketolase (EC:4.1.2.9)
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
kse  Kytococcus sedentarius
Pathway
Pentose phosphate pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kse00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Ksed_02820
Enzymes [BR:kse01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     Ksed_02820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
273585..276047
Genome map
AA seq 820 aa AA seqDB search
MITVPAWPDDPATPLDDEEARRLHAWWRAANYLSVGQIYLLDNPLLREELAPEHVKPRLL
GHWGTTPGLTFLYAHFNRAIRQRGLNACYVTGPGHGGPGLVAATYLEGTWTETYPDVGQD
LDGLQRLCKQFSFPGGIPSHVAPEVPGSIHEGGELGYSLSHAYGAMLDNPDQIAFTVVGD
GEAETGPLATSWHANKFSDPQHDGVVLPVLHLNGYKIANPTVLARIPEEELVSLMRGYGH
TPLLFTAGFDDEDELSVHRRFAAVLDEALDLIAQIKADAGPDSPRPAWPMIVFRTPKGWT
GPEQVDGKQTEGHWRSHQVPLANARDTPEHLEVLANWLRSYRPEELFAQDGALLPEIAAM
APQGEKRMSANPITNGGSVLRDLMLPDFRDHAVELTSPGQPFSEATSVLGGYLREVMRRN
PETFRLFGPDETASNRLQAVYEVTDKQWNAEYHPSDAEDPMARAGRVLEMLSEHQCQGWL
EGYLLTGRHGMLNSYEAFVHIVDSMVNQHAKWYKVTNQLEWRRPLASLNYLLSSHVWRQD
HNGFSHQDPGFIDHVVNKKAEIVRVYLPPDANTLLSTVDHCLRSRQYVNVVVAGKQPNPT
WLTMEEAIAHCVRGIGIWPWAGTESDGDDPDVVLGCAGDIPTIEVLAAAKILREEVPGLT
FRVVNVVDLMRLQDEKAHPHGLSETQFHTLFPAGTPVVFGYHGYPWLIHRLVYRHDTASH
FHVRGYTEEGTTTTPFDMVMRNQLDRYQLVVDVIDRVPALGSRYARLRQRMEDKRLQARA
HAYEHGEDLPEVAQWQWGDAQDEADAQQGSVRQDTGGDNV
NT seq 2463 nt NT seq  +upstreamnt  +downstreamnt
atgatcaccgtccccgcctggcccgatgaccccgccacgcccctggacgacgaggaggcc
cgccgcctgcacgcgtggtggcgcgcggcgaactacctctccgtggggcagatctacctg
ctggacaacccgctgctgcgggaggagctcgcgcccgagcacgtgaagccccgcctgctg
ggccactggggcaccaccccgggcctgaccttcctctacgcgcacttcaaccgcgccatc
cgccagcggggcctgaacgcgtgctacgtcaccgggcccggccacggcggaccgggtctg
gtggccgccacctacctcgagggcacctggaccgagacctaccccgacgtggggcaggac
ctcgacgggctgcagcgcctgtgcaagcagttctccttccccggcggcatcccctcccac
gtggcgccggaggtcccggggtcgatccacgagggcggggagctggggtattcgctctcg
cacgcctacggggcgatgctggacaaccccgaccagatcgccttcacggtcgtcggtgac
ggggaggccgagaccgggccgctggcgacctcctggcacgcgaacaagttctcggacccg
cagcacgacggggtggtcctgccggtgctgcacctcaacgggtacaagatcgccaacccg
acggtgctggcccgcatccccgaggaggagctcgtctccctgatgcggggctacggccac
acgccgctgctgttcaccgccgggttcgacgacgaggacgagctctccgtccaccgccgg
ttcgccgccgtgctggacgaggcgctcgacctcatcgcgcagatcaaggccgatgcgggg
ccggactcgccgcgcccagcctggccgatgatcgtgttccgcacccccaaggggtggacc
ggccccgagcaggtggatggcaagcagaccgagggtcactggcgctcgcaccaggtgccg
ctggccaacgcccgtgacacccccgagcacctggaggtcctcgcgaactggctgcgctcg
taccggccggaggagctcttcgcccaggacggcgccctgttgcccgagatcgccgcgatg
gcgccgcagggcgagaagcgcatgtcggccaaccccatcaccaacggcggcagcgtgctg
cgcgacctgatgctgccggacttccgcgaccacgccgtcgagctgacctcacccggccag
cccttctcggaggcgacgagcgtgctggggggctacctgcgggaggtgatgcgcaggaac
cccgagaccttccgcctgttcgggccggacgagacggcgtcgaaccgcctgcaggccgtg
tacgaggtcaccgacaagcagtggaacgccgagtaccacccgagcgacgccgaggacccg
atggcgcgcgccgggcgggtgctggagatgctctcggagcaccagtgccaggggtggctg
gagggttacctgctcaccgggcgccacgggatgctgaactcctacgaggccttcgtccac
atcgtcgactcgatggtgaaccagcacgccaagtggtacaaggtcaccaaccagctcgag
tggcggcgcccgctggcctcgttgaactacctgctctcctcgcacgtgtggcggcaggac
cacaacggcttctcccaccaggaccccgggttcatcgaccacgtggtcaacaagaaggcg
gagatcgtgcgggtgtacctgccgccggacgcgaacaccctgctctcgacggtggaccac
tgcctgcgctcccggcagtacgtcaacgtggtggtggccggcaagcagccgaaccccacg
tggttgacgatggaggaggcgatcgcccactgcgtgcgcggcatcggcatttggccgtgg
gccgggacggagtccgacggtgacgaccccgacgtggtgctgggctgcgcgggcgacatc
cccaccatcgaggtcctggcggccgcgaagatcctgcgcgaggaggtgccggggctgacc
ttccgggtcgtgaacgtggtggacctgatgcgcctgcaggacgagaaggcccacccgcac
gggctgtccgagacgcagttccacacccttttccccgccggcacacccgtggtcttcggg
taccacggctacccgtggctgatccaccgcctggtctaccggcacgacaccgcatcacac
ttccacgtgcgcgggtacaccgaggagggcaccaccaccacgcccttcgacatggtgatg
cgcaaccagctggaccgctaccagctggtggtcgacgtcatcgaccgcgtgccggccctg
ggttcgcgctacgcccggctccgccagcgcatggaggacaagcgactgcaggcccgtgcc
cacgcctacgagcacggggaggacctgcccgaggtcgcccagtggcagtggggtgacgcc
caggacgaggccgatgcccagcagggcagcgtgcgtcaggacaccggcggcgacaacgtc
tga

DBGET integrated database retrieval system