KEGG   Kytococcus sedentarius: Ksed_03400Help
Entry
Ksed_03400        CDS       T00974                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
kse  Kytococcus sedentarius
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:kse00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
325803..326780
Genome map
AA seq 325 aa AA seqDB search
MTAQPAPRIATVRVPAKVNLALRVGAPDPGSGYHPLATVFHAVDLTDEVTVRRARRFSLE
VTGRFTEGVPADETNLAWQAVVLLRHHYRQTCGVRTPLPVAITLEKNIPVAGGMAGGSAD
AAGALLAANEVWGNELTIEDLRDIAAELGADVPFALLGGNALGLGRGDELSTVLARGQLH
WVFCVSPEGLSTPEVYRAFDRLAGWDQGPTMDTIEAWETPPEPPEDLLQALRSGDAVEVG
QHLENDLQEAAVELQPGLRETLAAGADVGALTGIVSGSGPTIALLASSHDHALDISVGMA
ALRPEVEVFVASGPAPGARVVSTRS
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgaccgctcagccggccccccgcatcgccaccgtccgcgttcccgcgaaggtgaacctc
gcgctgcgggtgggcgccccggacccggggagcggctaccacccgctggccaccgtcttc
cacgccgtcgacctgaccgatgaggtgaccgtccggcgcgcgcgccgcttctccctggag
gtgaccggccggttcaccgagggggtgccggccgacgagacgaacctcgcctggcaggcc
gtggtgctcctgcgccaccactaccgccagacctgtggggtgcggaccccgctgccggtg
gcgatcaccctcgagaagaacatcccggtggccgggggcatggccgggggttccgcggac
gccgcgggggccctcttggctgcgaacgaggtgtggggcaacgagctgaccatcgaggac
ctgcgcgacatcgctgccgagctgggcgccgacgtccccttcgccctgctgggcggcaac
gccctgggcctggggcgcggcgacgagctgtccacggtgctcgcgcggggccagctccac
tgggtgttctgcgtgagccccgagggcctgagcacgccggaggtctaccgcgcgttcgac
cgcctcgccgggtgggaccagggaccgacgatggacacgatcgaggcgtgggagaccccg
cccgagccgccggaggacctgctccaggccctgcgctccggggacgccgtcgaggtgggg
cagcacctggagaacgacctgcaggaggccgccgtcgagctgcagcccggcctgcgcgag
accctggcggccggtgccgatgtgggggccctgaccggcatcgtctcgggctccgggccc
accatcgcgctgttggcctccagccacgaccacgcgctggacatctcggtgggcatggcc
gccctgcgcccggaggtcgaggtcttcgtcgcctcgggtccggcgcccggcgcgcgcgtg
gtctccacccgctcctga

DBGET integrated database retrieval system