KEGG   Kytococcus sedentarius: Ksed_03670Help
Entry
Ksed_03670        CDS       T00974                                 

Definition
phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
kse  Kytococcus sedentarius
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:kse00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ksed_03670
   01230 Biosynthesis of amino acids
    Ksed_03670
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ksed_03670
  Energy metabolism
   00680 Methane metabolism
    Ksed_03670
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ksed_03670
Enzymes [BR:kse01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Ksed_03670
Exosome [BR:kse04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Ksed_03670
  Exosomal proteins of melanoma cells
   Ksed_03670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
352673..353428
Genome map
AA seq 251 aa AA seqDB search
MTNAAHTLVLLRHGQSLWNEKNLFTGWVDVDLTEKGRAEARRGGELLVAEGYLPDVLHTS
RLRRAITTANLALDAADRHWIDVKRSWRLNERHYGALQGKDKAQVKDKYGEEQFMAWRRG
YDTPPPPIEADDEYSQAGDPRYADLGAEVPATECLKDVVERLRPYWAEEIVPDLQAGRTV
LVTAHGNSLRALVKELDGISDADIAELNIPTGIPLVYELDGNFRPLTPGGRYLDPEAAAG
AIQEVANQGSK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaccaacgctgctcacacccttgtcctgctgcgccacggccagagcctgtggaacgag
aagaacctcttcaccgggtgggtcgacgtcgacctcaccgagaaggggcgcgccgaggcc
cgccgcggtggtgagctgctggtggccgagggctacctgccggacgtgctgcacacctcc
cgcctgcggcgcgcgatcacgacggccaacctggccctcgatgccgccgaccgccactgg
atcgacgtgaagcgctcctggcgcctcaacgagcgccactacggcgcactgcagggcaag
gacaaggcacaggtcaaggacaagtacggcgaggagcagttcatggcctggcgccgcggc
tacgacaccccgccgccccccatcgaggccgacgacgagtactcgcaggcgggtgatcct
cgctacgccgacctgggcgccgaggtgccggccaccgagtgcctcaaggacgtcgtggag
cggctgcgtccctactgggccgaggagatcgtgcccgacctgcaggccggcaggacggtg
ctggtcaccgcccacggcaacagcctgcgcgccctggtcaaggagctcgacggcatcagc
gacgccgacatcgccgagctgaacatccccaccggcatcccgctggtgtacgagctcgac
gggaactttcgccccctgacccccggcgggcgctatctcgaccccgaggccgccgccggc
gccatccaggaggtcgcgaaccagggcagcaagtga

DBGET integrated database retrieval system