KEGG   Kytococcus sedentarius: Ksed_03670Help
Entry
Ksed_03670        CDS       T00974                                 

Definition
phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
kse  Kytococcus sedentarius
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:kse00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ksed_03670
   01230 Biosynthesis of amino acids
    Ksed_03670
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ksed_03670
  Energy metabolism
   00680 Methane metabolism
    Ksed_03670
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ksed_03670
Enzymes [BR:kse01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Ksed_03670
Exosome [BR:kse04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Ksed_03670
  Exosomal proteins of melanoma cells
   Ksed_03670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
352673..353428
Genome map
AA seq 251 aa AA seqDB search
MTNAAHTLVLLRHGQSLWNEKNLFTGWVDVDLTEKGRAEARRGGELLVAEGYLPDVLHTS
RLRRAITTANLALDAADRHWIDVKRSWRLNERHYGALQGKDKAQVKDKYGEEQFMAWRRG
YDTPPPPIEADDEYSQAGDPRYADLGAEVPATECLKDVVERLRPYWAEEIVPDLQAGRTV
LVTAHGNSLRALVKELDGISDADIAELNIPTGIPLVYELDGNFRPLTPGGRYLDPEAAAG
AIQEVANQGSK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaccaacgctgctcacacccttgtcctgctgcgccacggccagagcctgtggaacgag
aagaacctcttcaccgggtgggtcgacgtcgacctcaccgagaaggggcgcgccgaggcc
cgccgcggtggtgagctgctggtggccgagggctacctgccggacgtgctgcacacctcc
cgcctgcggcgcgcgatcacgacggccaacctggccctcgatgccgccgaccgccactgg
atcgacgtgaagcgctcctggcgcctcaacgagcgccactacggcgcactgcagggcaag
gacaaggcacaggtcaaggacaagtacggcgaggagcagttcatggcctggcgccgcggc
tacgacaccccgccgccccccatcgaggccgacgacgagtactcgcaggcgggtgatcct
cgctacgccgacctgggcgccgaggtgccggccaccgagtgcctcaaggacgtcgtggag
cggctgcgtccctactgggccgaggagatcgtgcccgacctgcaggccggcaggacggtg
ctggtcaccgcccacggcaacagcctgcgcgccctggtcaaggagctcgacggcatcagc
gacgccgacatcgccgagctgaacatccccaccggcatcccgctggtgtacgagctcgac
gggaactttcgccccctgacccccggcgggcgctatctcgaccccgaggccgccgccggc
gccatccaggaggtcgcgaaccagggcagcaagtga

DBGET integrated database retrieval system