KEGG   Kytococcus sedentarius: Ksed_07520Help
Entry
Ksed_07520        CDS       T00974                                 

Definition
beta-glucosidase-like glycosyl hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
kse  Kytococcus sedentarius
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:kse00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Ksed_07520
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Ksed_07520
Enzymes [BR:kse01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Ksed_07520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
753685..755184
Genome map
AA seq 499 aa AA seqDB search
MADLPVEKLAGQVIVAGYEGTGAAGASQFVADGFGGVIAFAANVPQEVTQLAAVNVAVQE
AQARSGRDWPAVIGVDQEGGPVQRLGEPVTQFPAGMAHGAAADADLSREVARHSGEQLRA
LGFTMVFAPDADVTVGPQDPTIGVRSPGSDPERVAEVALALAEGYRDAGIVPVAKHFPGH
GGLTTDSHVGLPATDATADELAAHDLVPFSALAQQDVPVMVGHIEVTALDDLPATLSTRT
TGLLRDTAGPDVLVVTDALNMGALDAAEESTGQDRSVAALAAGSDLLLMPPDPRAARAAI
VQAVADGTLDEERLRDAASHVVAASLQTGAEPARGLPAAGEGQPLAERLAAASLTSLGET
CDPAVLSSGDTVRVVGGTDEHRAALGRALRTVGLRVSGQGETTVRLVEGGDYAAGQVEDG
QMPQDTASGPREGGDSADVAVALDVPYGLEGVEAPIELAAFGDTPAHLAAVAQSLVGEVE
PLGTLPVPVGDRQAGATCG
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
gtggccgacctccccgtcgagaagctggccgggcaggtgatcgtcgccggctacgagggc
acgggggccgccggggcctcgcagttcgtggccgacggcttcgggggagtgatcgcgttc
gcggcgaacgtgccgcaggaggtcacgcagctcgccgcggtcaacgtggccgtccaggag
gcccaggcgaggtccgggcgcgactggcccgccgtcatcggcgtggaccaggagggcggg
ccggtgcagcgcctgggggagccggtcacgcagttccccgccggcatggcccacggggcc
gcggccgacgcagacctctcgcgcgaggtggcccgccacagcggcgagcagctgcgcgcg
ctgggcttcacgatggtgttcgcccccgacgcggacgtgaccgtcggcccccaggacccc
accatcggggtccgttcaccggggtccgaccccgaacgggtggccgaggtggcactcgcg
ctcgcggagggctaccgcgacgcgggcatcgtgccggtggccaagcacttccctggccac
ggtggactgaccaccgacagccacgtgggcctgcccgccaccgacgccaccgccgacgag
ctcgccgcccacgacctcgtgccgttctccgccctggcgcagcaggacgtgccggtgatg
gtcgggcacatcgaggtgaccgccctggacgacctgccggccaccctgagcacccgcacc
acgggcctcctgcgcgacacggccgggccggacgtcctggtggtgaccgacgcgctcaac
atgggcgcgttggacgccgcggaggagtccacggggcaggaccgttccgtcgcggcactg
gccgccggctcggacctgctgctcatgccgccggacccgcgggcggcgcgcgcggccatc
gtgcaggccgtggccgacggcaccctggacgaggagcgcctgcgcgacgccgcgagccac
gtggtggccgcgagcctgcagaccggcgcggagcccgcccggggcctccccgcggcgggc
gagggccagccgctggccgagcgcctggctgccgcatcgctcacctcgctcggggagacc
tgcgaccccgcggtgctgtcctctggcgacaccgtccgggtggtcggtggcaccgacgag
caccgcgccgccctcggcagggccctgcgcaccgttggcctgcgggtgtccgggcagggc
gagaccactgtgcgcctcgtcgaggggggcgactacgccgcgggccaggtggaggacggg
cagatgccgcaggacaccgcatcgggcccgcgggaggggggcgactccgccgacgtggcc
gtcgcgctggacgtgccctacggcctcgagggggtcgaggcgcccatcgagctggcggcc
ttcggggacacgccggcccacctcgcggccgtcgcgcagtcgctcgtgggtgaggtggag
cccctcggcaccctgccggtcccggtgggggaccggcaggccggggccacctgcggctga

DBGET integrated database retrieval system