KEGG   Kytococcus sedentarius: Ksed_07730Help
Entry
Ksed_07730        CDS       T00974                                 

Definition
(GenBank) succinyl-CoA synthetase (ADP-forming) beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
kse  Kytococcus sedentarius
Pathway
kse00020  Citrate cycle (TCA cycle)
kse00640  Propanoate metabolism
kse00660  C5-Branched dibasic acid metabolism
kse01100  Metabolic pathways
kse01110  Biosynthesis of secondary metabolites
kse01120  Microbial metabolism in diverse environments
kse01130  Biosynthesis of antibiotics
kse01200  Carbon metabolism
Module
kse_M00009  Citrate cycle (TCA cycle, Krebs cycle)
kse_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:kse00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Ksed_07730
   00640 Propanoate metabolism
    Ksed_07730
   00660 C5-Branched dibasic acid metabolism
    Ksed_07730
Enzymes [BR:kse01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Ksed_07730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATPgrasp_Ter
Motif
Other DBs
NCBI-ProteinID: ACV05829
UniProt: C7NF05
Position
780602..781786
Genome map
AA seq 394 aa AA seqDB search
MDLFEYQARDMFEKHGVPVLAGEVATTPEEARAAAERIGQKSGGVVVVKAQVKTGGRGKA
GGVKVVKSPEEAQEAAEAILGMDIKGHTVHTVMIAQGAKIAEEYYFSILLDRTNRSYLAM
CSKEGGVEIEQLAVERPEALARIEIDPSVGLDDAKAAEIVEAAGFTDSKDELAKTFKTLY
TVYTEEDASLVEVNPLVKTEDGEIIALDGKVTLDENSDFRQPHHADLEDKEAADPLEAKA
KAKGLNYVKLDGNVGIIGNGAGLVMSTLDVVAYAGEDKTGGKAKPANFLDIGGGASAQVM
ADGLDVILGDEQVKSVFVNVFGGITACDAVANGIVQALEMLGDDATKPLVVRLDGNNVEE
GRKILADANHPLVSIADTMDGGAEKAAELAAKEN
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
gtggatctcttcgagtaccaggcccgtgacatgttcgagaagcacggggttccggtgctg
gccggtgaggtcgccaccacccccgaagaggctcgagctgccgcggagcgaatcggacag
aagtccggtggtgtcgtggtcgtcaaggcccaggtcaagaccggtgggcgtggcaaggcc
ggcggtgtgaaggtcgtgaagtcccccgaggaggcgcaggaggccgctgaggccatcctc
ggcatggacatcaagggccacaccgtgcacacggtgatgatcgcccagggcgccaagatc
gccgaggagtactacttctccatcctgctggaccgcaccaaccgctcctacctggccatg
tgctcgaaggagggcggcgtcgagatcgagcagctcgccgtcgagcgcccggaggcgctg
gcccgcatcgagatcgacccgtcggtcggtctggatgacgcgaaggccgccgagatcgtc
gaggccgccgggttcaccgacagcaaggacgagctcgccaagaccttcaagaccctgtac
acggtctacaccgaggaggacgcctcgctggtcgaggtgaacccgctggtgaagaccgag
gacggcgagatcatcgcgctggacggcaaggtcacgctggacgagaactccgacttccgt
cagccgcaccacgcggacctggaggacaaggaggccgcggacccgctggaggccaaggcc
aaggccaagggcctcaactacgtgaagctcgacggcaacgtcggcatcatcggcaacggc
gccggcctcgtgatgtccaccctggacgtcgtggcctacgccggcgaggacaagaccggt
ggcaaggccaagccggccaacttcctggacatcggtggcggcgcctcggcgcaggtcatg
gccgacggcctcgacgtgatcctcggcgacgagcaggtcaagagcgtcttcgtgaacgtc
ttcggcggcatcaccgcctgcgacgccgtggccaacggcatcgtgcaggcgctcgagatg
ctgggtgacgacgccaccaagccgctggtcgtgcgcctggacggcaacaacgtcgaggag
ggtcgcaagatcctcgccgacgccaaccacccgctggtgagcattgccgacacgatggac
ggcggcgccgagaaggcggccgagctggccgcgaaggagaactga

DBGET integrated database retrieval system