KEGG   Kytococcus sedentarius: Ksed_07750Help
Entry
Ksed_07750        CDS       T00974                                 

Definition
Zn-dependent alcohol dehydrogenase, class III
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
kse  Kytococcus sedentarius
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:kse00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Ksed_07750
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ksed_07750
  Lipid metabolism
   00071 Fatty acid degradation
    Ksed_07750
  Amino acid metabolism
   00350 Tyrosine metabolism
    Ksed_07750
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Ksed_07750
   00626 Naphthalene degradation
    Ksed_07750
Enzymes [BR:kse01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Ksed_07750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
782813..783964
Genome map
AA seq 383 aa AA seqDB search
MSTHPGPLHTTGAVLRTLQAEAPYAQSAPLEVRRLDLDPPGEREILVRIEAASVCHSDLS
VVQGRRPRPLPMLLGHESAGIVEAVGPGVSTVGRGDRVVMTFLPRCGACEACDTEGRLPC
TPGSAANERGDLLGGGRRLHADGESVAHHLGVSGFATHAVVDERSVVPVEADVPADVAAV
LGCAVLTGGGAVMNVVELRRSSTIVVVGLGGVGMAAVLVARALGHEVVGVDGIASKRELA
RELGAARAWSPQEATEQEVRGHLVVDATGNPRGFETAVALTAPGGTTVTVGLPPADAEST
LRPLALVAQARTITGSYLGSAVPRRDIPRFVDLWRQGRLPIERLISSHIGLEEINRAMDR
LEAGDELRQVILLTDAPGEAAPA
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgcacccgggccccctgcacaccaccggagcggtcctgcgcacgctgcaggcc
gaggccccctacgcgcagtcggcacccctggaggtgcggcgcctcgacctggacccgccc
ggcgagcgggagatcctggtgcgaatcgaggccgccagcgtgtgccactccgacctctcg
gtggtccaggggaggcgtccgcgcccgctgcccatgctgctggggcacgagtccgccggc
atcgtcgaggcggtcggtcccggggtgtcgaccgtcgggcggggcgaccgggtggtcatg
accttcctgccgcggtgcggcgcgtgcgaggcctgcgacaccgagggccggctgccctgc
acccccggatcggcggccaacgagcgtggtgatctgctgggcggtgggcgccggctgcac
gcggacggggagtcggtggcgcaccacctgggtgtctcgggcttcgccacccacgccgtc
gtcgacgagcgctcggtcgtgccggtggaggccgacgtgccggccgatgtggctgccgtg
ctgggctgcgcggtcctcaccggtgggggagcggtgatgaacgtggtggagcttcgtcgc
agcagcaccatcgtggtcgtcgggctgggtggggtgggcatggccgccgtcctggtcgcg
cgtgcgctgggccacgaggtggtgggtgtcgacggcatcgcgagcaagcgtgagctggct
cgcgagctcggtgcggcccgggcctggtcgcctcaggaggccaccgagcaggaggtccgc
ggccacctggtggtggacgccaccggcaacccccgcggcttcgagaccgccgtggccctg
accgcacccggtggcaccaccgtcaccgtcggcctgcccccggccgatgccgagagcacc
ctgcggccgctggccctggtcgcgcaggcccgcaccatcaccggcagctacctcggctcg
gcggtcccgcgtcgtgacatcccccggttcgtcgacctgtggcgccagggcaggctgccg
atcgagcgcctcatcagctcccacatcgggctcgaggagatcaaccgcgccatggaccgc
ctcgaggccggtgacgagctgcggcaggtgatcctcctgaccgacgccccgggcgaggct
gcacccgcctga

DBGET integrated database retrieval system