KEGG   Kytococcus sedentarius: Ksed_08120Help
Entry
Ksed_08120        CDS       T00974                                 

Definition
thymidine phosphorylase (EC:2.4.2.2)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
kse  Kytococcus sedentarius
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kse00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Ksed_08120
Enzymes [BR:kse01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Ksed_08120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
824940..826241
Genome map
AA seq 433 aa AA seqDB search
MTGTQHDAVDIIRTKRDGERLSDEQIDWVIDAYTRGDVADEQMSALAMAIYLNGMEPDEI
SRWTSAMIASGERMDFSTLSRPTADKHSTGGVGDKITLPLAPLVAACGVAVPQLSGRGLG
HTGGTLDKLEAIPGWQADLTNEAMMQQLEEVGAVICAAGAGLAPADKKLYALRDVTGTVE
ALPLIASSIMSKKIAEGTGALVLDVKVGSGAFMKTEADARALAERMVALGDAAGVTTVAL
LTDMSAPLGRTAGNGLEVIESVEVLSGGGPADVRELTIALAREMVLASGIEGADAVDVAE
VLDSGKALQVWKQMIAAQGGDPEAELALGEHTAEVTAEAGGVITEMDAYKVGVAAWRLGA
GRARKEDPVQAGAGVRWHAGVGERVEAGQVLFTCYTETSERLQRGVETLAGAVTIDTGAE
PFERTLVIDRITA
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgaccggaacgcagcacgacgccgtggacatcatccgcaccaagcgcgacggagagcgc
ctctccgacgagcagatcgactgggtgatcgacgcctacacccggggggacgtcgccgac
gagcagatgtcggccctggccatggccatctacctcaacggcatggagcccgacgagatc
tcccgctggacctccgccatgatcgcatcgggggagcggatggacttctccaccctgtcg
cgccccaccgcggacaagcactcgaccgggggtgttggcgacaagatcaccctcccgctg
gcccccctggtggcggcctgcggggtcgcggtcccgcagctctccggacgcgggctgggc
cacaccggcggcaccctggacaagctcgaggccatccccggctggcaggccgacctgacc
aacgaggcgatgatgcagcagctcgaggaggtcggggccgtcatctgtgccgcgggcgcc
gggctggcccccgcggacaagaagctctacgccctgcgcgacgtgaccggcacggtcgag
gcgctgcccctcatcgccagctcgatcatgtccaagaagatcgccgagggcaccggcgcg
ctggtgctcgacgtgaaggtgggctccggcgcgttcatgaagaccgaggcagacgcccgg
gccctggccgagcgtatggtggccctgggcgatgccgccggtgtcaccaccgtcgcgctg
ctcaccgacatgtctgccccgctgggccggacggcgggcaacggcctcgaggtcatcgag
tccgtcgaggtcctctccggcgggggaccggcggacgtgcgcgagctgacgatcgccctg
gcccgcgagatggtgctggcctccggcatcgagggggccgatgcggtggacgtcgccgag
gtgctggactccggcaaggcgcttcaggtgtggaagcagatgatcgccgcccagggtggg
gaccccgaggccgagctggctctgggggagcacaccgccgaggtcacggccgaggccggt
ggcgtcatcacggagatggacgcctacaaggtgggtgtcgccgcgtggcgcctgggtgcg
ggccgtgcccgcaaggaggacccggtgcaggccggtgccggggtgcgctggcacgcgggc
gtcggggagcgcgtggaggccgggcaggtgctgttcacctgctacaccgagacgtcggag
cgcctgcagcgcggggtggagaccctcgccggcgcggtgacgatcgacaccggcgccgag
cccttcgagcgcacactggtgatcgaccgcatcacggcctga

DBGET integrated database retrieval system