KEGG   Kytococcus sedentarius: Ksed_08980Help
Entry
Ksed_08980        CDS       T00974                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
kse  Kytococcus sedentarius
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:kse00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ksed_08980
   01230 Biosynthesis of amino acids
    Ksed_08980
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ksed_08980
   00030 Pentose phosphate pathway
    Ksed_08980
   00051 Fructose and mannose metabolism
    Ksed_08980
   00052 Galactose metabolism
    Ksed_08980
  Energy metabolism
   00680 Methane metabolism
    Ksed_08980
Enzymes [BR:kse01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Ksed_08980
Protein phosphatases and associated proteins [BR:kse01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Ksed_08980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
916455..917477
Genome map
AA seq 340 aa AA seqDB search
MRIGILTSGGDCPGLNAVIRGAVLKGDRIHGHEFLGIKDGWRGLVEDDVAPLPRHQIRGL
SKQGGTILGTSRVGPYGEGNGGAQRVRETMQRRGMDALIAIGGEGTLTVARMLHDEGIDV
VGVPKTIDNDLGATDYTFGFDTAVHVATEAIDRLRTTGDSHHRCMVLEVMGRHAGWIALH
AGIAGGAHAVLIPEVAVGYDQVAQWVRATADRGRAPMVVVAEGFMPDGELVSGGQVDGMG
RPRLGGVGEQVAREIEERTGIESRAMALGHMQRGGSPTAYDRVLATRFGTAALDAVHDRA
FGQMVALAGTEIVRVPLAEATTALKSVPRERWDEAAILFG
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatcggcatcctgacctccggcggggactgccccggtctcaacgccgtcatccgc
ggagccgtcctcaagggcgatcgcatccacggccacgagttcctcggcatcaaggacggt
tggcggggcctggtcgaggacgacgtcgcgcccctgccccgccaccagatccgcggcctg
agcaagcagggcggcaccatcctgggcacctcccgggtgggtccctacggcgagggcaac
gggggcgcccagcgcgtccgcgagaccatgcagcggcgcgggatggacgccctcatcgcc
atcgggggagagggcacgctcaccgtggcgcggatgctccacgacgagggcatcgacgtg
gtgggggtccccaagaccatcgacaacgacctcggtgccaccgactacaccttcggcttc
gataccgcggtgcacgtggccaccgaggccatcgaccggctccgcaccaccggcgacagc
caccaccggtgcatggtcctggaggtgatgggccgccacgcagggtggatcgccctgcac
gcgggcatcgccggtggcgcccacgcggtgctcatccccgaggtcgccgtcggctacgac
caggtggcgcagtgggtgcgggcgaccgccgaccgcgggcgggccccgatggtggtggtc
gccgagggcttcatgcccgacggcgagctcgtctccggcggtcaggtggacggcatgggc
cgcccgcgcctcggcggggtgggggagcaggtggcacgggagatcgaggagcgcaccggc
atcgagtcgcgcgccatggcgctgggccacatgcagcgcgggggctcacccaccgcctat
gaccgggtgctggccacgcgcttcggtaccgcggccctcgatgcggtgcacgaccgtgcc
ttcggccagatggtggccctggcgggcaccgagatcgtgcgcgttccgctggccgaggcg
accacggcgctcaagagcgtcccgcgggagcggtgggacgaggcggccatcctgttcggg
tga

  All links  
No link information was found.   
DBGET integrated database retrieval system