KEGG   Kytococcus sedentarius: Ksed_08980Help
Entry
Ksed_08980        CDS       T00974                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
kse  Kytococcus sedentarius
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:kse01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:kse01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:kse00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:kse00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:kse00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:kse00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:kse00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
916455..917477
Genome map
AA seq 340 aa AA seqDB search
MRIGILTSGGDCPGLNAVIRGAVLKGDRIHGHEFLGIKDGWRGLVEDDVAPLPRHQIRGL
SKQGGTILGTSRVGPYGEGNGGAQRVRETMQRRGMDALIAIGGEGTLTVARMLHDEGIDV
VGVPKTIDNDLGATDYTFGFDTAVHVATEAIDRLRTTGDSHHRCMVLEVMGRHAGWIALH
AGIAGGAHAVLIPEVAVGYDQVAQWVRATADRGRAPMVVVAEGFMPDGELVSGGQVDGMG
RPRLGGVGEQVAREIEERTGIESRAMALGHMQRGGSPTAYDRVLATRFGTAALDAVHDRA
FGQMVALAGTEIVRVPLAEATTALKSVPRERWDEAAILFG
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatcggcatcctgacctccggcggggactgccccggtctcaacgccgtcatccgc
ggagccgtcctcaagggcgatcgcatccacggccacgagttcctcggcatcaaggacggt
tggcggggcctggtcgaggacgacgtcgcgcccctgccccgccaccagatccgcggcctg
agcaagcagggcggcaccatcctgggcacctcccgggtgggtccctacggcgagggcaac
gggggcgcccagcgcgtccgcgagaccatgcagcggcgcgggatggacgccctcatcgcc
atcgggggagagggcacgctcaccgtggcgcggatgctccacgacgagggcatcgacgtg
gtgggggtccccaagaccatcgacaacgacctcggtgccaccgactacaccttcggcttc
gataccgcggtgcacgtggccaccgaggccatcgaccggctccgcaccaccggcgacagc
caccaccggtgcatggtcctggaggtgatgggccgccacgcagggtggatcgccctgcac
gcgggcatcgccggtggcgcccacgcggtgctcatccccgaggtcgccgtcggctacgac
caggtggcgcagtgggtgcgggcgaccgccgaccgcgggcgggccccgatggtggtggtc
gccgagggcttcatgcccgacggcgagctcgtctccggcggtcaggtggacggcatgggc
cgcccgcgcctcggcggggtgggggagcaggtggcacgggagatcgaggagcgcaccggc
atcgagtcgcgcgccatggcgctgggccacatgcagcgcgggggctcacccaccgcctat
gaccgggtgctggccacgcgcttcggtaccgcggccctcgatgcggtgcacgaccgtgcc
ttcggccagatggtggccctggcgggcaccgagatcgtgcgcgttccgctggccgaggcg
accacggcgctcaagagcgtcccgcgggagcggtgggacgaggcggccatcctgttcggg
tga

DBGET integrated database retrieval system