KEGG   Kytococcus sedentarius: Ksed_09520Help
Entry
Ksed_09520        CDS       T00974                                 

Definition
alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
kse  Kytococcus sedentarius
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:kse00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Ksed_09520
Enzymes [BR:kse01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Ksed_09520
Exosome [BR:kse04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Ksed_09520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(976287..980249)
Genome map
AA seq 1320 aa AA seqDB search
MSTATLKHLLEDWLPRQRWFAGKGHTPRLQRIGTVRMGDVVDPAGQTVALSTVYVADRAT
VPATVYQVPLSVHPLPSGDAGDSSDGPGSSDGSGTDAGKGAAQPVGGRIGEISLATMGLS
SDPLARGTVHDAAHDPAYAAAVMAMADRESTYGQGVATMRGNQLRPRRPHKAPYIVTGSR
VLPGEQSNTSIIVTTLGGRPNAPQRETAIVKLFRVVQVGANPDVELQLELARQGSTVIPT
PLGAVEGSWPDPETGEERRGHLAFASEYLGDVDDAWRVALRSAARGKKFLKRARRLGESV
AQVHAELATALGTVQVDHTHRQELTDRLRTRLQAALAQAPELEPLRAEATARIDALEALS
WPALQRVHGDLHLGQVLDVPDRGWVVLDFEGEPLRPVAERRAPDLPLRDVAGMLRSFDYV
AGSLAHDESEGADHEATLAAWVQGVRAAFLEGYRSVAGDRGTEPRLLLEALEVDKAFYEV
VYERHNRPDWVDIPVSALERLLGTSVGSAEAGTEPGEPTTAAPSGTAATEPGAEEHGTTE
GARPQGGATRLELAPAPQDGHPGTQPTSPPAEPTDPAGISREEAHRIVEGRSHDPHAVLG
LHPVADGIVIRALRPRARRVVALLPDGSRHELHHLADGIFGAHLPGQSPTDYRLEVVWPL
PATADEARSDHAAEAQPRVQDDGYRYLPGVGEMDLHLIGEGRHERLWTVLGAHVRTHDGP
MGASSGVAFTVWAPHAHGVRVVGDFNHWDGTGHPMRALGSSGVWELFVPGIGAGERYKFQ
ITTAQGTTVTKADPMARRTELPPATASIVDDSHAEGYPWTDADWLARRAEGTPQTAPMST
YEVHLGSWRQGLGYTELAEQLVQHVTDLGFTHVELLPVAEHPYAPSWGYQVTGYYAPTSR
FGSPDEFRHLVDALHAAGIGVILDWVPGHFPKDEWALARFDGQPLYEHPDPRRGDQPDWG
THVFDFGRHEVRNFLVANVLYWMEEFHVDGIRVDAVASMLYLDYSRAAGEWLPNQYGGRE
NLEAVQLLQETNATAHRLFPGIVTIAEESTAWPGVTAPTHEGGLGFSMKWNMGWMHDTLE
YASKDPVHRQFHHHELTFSMVYAYSENYVLPISHDEVVHGKGSLVTKMPGDTWQKYAGVR
VYLAFMWAHPGKKLLFMGSELGVPREWSEGTSLDFDIAGDPLRHGVQSAVRDLNRRYAEL
PALWQLDHQPTGFRWIDAENAAGNMVSFLRFGERPGDPGGTLAVLANFSGAPHEDFRVGL
PHAGRWREVLNTDAVEYGGSGVGNLGEVVAEDVPWDGLPASAVVRVPPLGAVWFTPVQEG
NT seq 3963 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccgcgaccctgaagcacctgctggaggactggctgccgcgccagcgctggttc
gccgggaagggccacacgccccgcctgcagcgcatcggcaccgtccgtatgggggacgtg
gtggaccccgcgggccagaccgtcgccctgtcgaccgtgtacgtggccgaccgcgccacc
gtgccggcgaccgtgtaccaggtccccctgtcggtgcacccgctcccgtccggtgacgcc
ggcgactcctccgacggccccggcagttccgacggttccggcacggacgcagggaagggg
gcggcccagccggtgggtggccgcatcggggagatctcgctggcaacgatggggctgtcc
tccgacccgctggcgcgcggcacggtgcacgacgccgcccacgatccggcctacgcagcg
gccgtgatggcgatggccgaccgggagagcacctacggccagggggtggcgacgatgcgg
ggcaaccagctgcgtccgcggcggccccacaaggctccctacatcgtgaccggctcccgg
gtgttgccgggtgagcagtcgaacacctccatcatcgtgaccaccctgggcgggcggccc
aacgcaccgcagcgggagaccgcgatcgtcaagctgttccgtgtggtgcaggtcggtgcg
aaccccgacgtcgagctgcagctggagctggcgcggcagggctcgaccgtcatccccacc
ccgctgggcgcggtcgaggggtcgtggcccgaccccgagaccggggaggagcgccgcggg
cacctcgccttcgccagcgagtacctgggggacgtggacgacgcgtggcgggtggcgctg
cgctcggcggcgcgcggcaagaagttcctcaagcgcgcccgccgtctgggtgagtccgtg
gcccaagtgcacgccgagctggcaacggcgctggggaccgtccaggtggaccacacccac
cggcaggagctcaccgaccggttgcggacacgcctgcaggccgccctggcccaggcaccg
gagctggagccgctccgcgcggaggcgaccgcccgcatcgacgcgttggaggccctgtcc
tggccggcgctgcagcgggtccacggcgacctgcacctggggcaggtgctcgacgtgccg
gaccggggctgggtggtgctggacttcgagggcgagccgctgcgtccggtcgcggagcgc
cgggcacccgacctcccgctgcgggacgtggccggcatgctgcgctccttcgactacgtc
gccggctcgctggcccacgatgagtccgagggcgcggaccacgaggcgacgctggccgcc
tgggtgcagggggtacgcgctgccttcctggagggctaccgctcggtggccggtgaccga
ggcaccgaaccccggctgctgctggaggccctggaggtcgacaaggccttctacgaggtg
gtctacgagcgccacaaccggccggactgggtcgacatcccggtctcggcgctggagcga
ctgctcggcacctccgtgggcagcgccgaggcaggcaccgagccgggcgagccgaccacc
gccgcgcccagcgggacggcggccaccgagccgggcgccgaggagcacggcaccaccgaa
ggcgcacgcccccagggcggggccacgcgcctcgagctcgcccccgcgccgcaggacggg
cacccggggacccagcccaccagccccccggcggagcccacggacccggccgggatcagc
cgggaggaggcccaccgcatcgtggaggggcgctcgcacgacccgcacgccgtgctgggc
ctgcacccggtggccgacggcatcgtgatccgggccctgcggccgcgggcccgccgcgtg
gttgccctgctgcccgacggctcccgccacgagctgcaccacctggccgatggcatcttc
ggggcccacctgccggggcagtcccccaccgactaccgcctcgaggtcgtctggccgctg
cctgcgaccgcggacgaggcacgctccgaccacgccgcggaggcccagccccgggtgcag
gacgacggctaccggtacctgcccggcgtcggggagatggacctgcacctcatcggggag
gggcgccacgagcggctctggaccgtcctgggcgcccacgtgcggacgcacgacggcccg
atgggggcgagctccggtgtcgcgttcaccgtgtgggcgccgcacgcccacggggtgcgc
gtggtcggcgacttcaaccactgggacggtaccggccacccgatgcgggcgctgggcagc
agcggcgtgtgggagctgttcgtgcccggcatcggcgccggcgagcggtacaagttccag
atcaccaccgcccaagggacgacggtcacgaaggctgacccgatggcgcggcgcaccgag
ctgccgcccgccaccgcgtcgatcgtggacgacagccatgccgagggctacccatggacc
gatgcggactggctggcgcggcgggcggagggaactccacagacggcgccgatgagtacc
tacgaagtgcacctcggctcctggcggcagggcctggggtacacggagctcgccgagcag
ctggtgcagcacgtcaccgacctgggcttcacccacgtggagctgctgccggtggccgag
cacccctacgcccccagctggggctaccaggtgacgggctactacgcgcccacctcgcgc
ttcggcagccccgacgagttccgacacctggtggacgcgctgcacgccgccggtatcggc
gtcatcctggactgggtgcccggccacttcccgaaggacgagtgggccctggcgcgcttc
gacggccagcccttgtacgagcaccccgacccccgccgcggcgaccagccggactggggc
acgcacgtgttcgacttcggccgccacgaggtgcgcaacttcctggtcgcgaacgtcctg
tactggatggaggagttccacgtcgacggcatccgcgtggacgcggtggcctccatgctc
tacctggactactcgcgggcggcgggtgagtggctgcccaaccagtacggcgggcgggag
aacctcgaggcagtgcagctgctgcaggagaccaacgccaccgcccaccggctgttcccc
ggcatcgtgaccatcgccgaggagtccaccgcgtggccgggcgtcaccgcccccacccac
gaggggggcctggggttctccatgaagtggaacatgggctggatgcacgacaccttggag
tacgcctccaaggaccccgtgcaccggcagttccaccaccacgagctgaccttctcgatg
gtgtacgcctactccgagaactacgtgctgccgatcagccacgacgaggtcgtgcacggc
aagggttcgctggtcacgaagatgccgggagacacctggcagaagtacgccggggtgcgg
gtgtacctggcgttcatgtgggcccacccgggcaagaagctgctgttcatgggcagtgag
ctgggggttccgcgggagtggtcggaggggacctcgttggacttcgacatcgccggcgac
cccctgcggcacggcgtgcagtccgccgtccgggacctcaaccggcgctacgccgagctg
cccgccctgtggcagctggaccaccagcccaccgggttccggtggatcgatgcggagaac
gcggccggcaacatggtgagcttcctgcgcttcggcgagcgcccgggcgaccccggcggc
accctggccgtgctggcgaacttctccggtgccccgcacgaggacttccgggtgggcctg
ccccacgcaggtcgctggcgcgaggtactgaacaccgacgccgtggagtacggcggctcg
ggcgtgggcaacctcggcgaggtggtggccgaggacgtgccgtgggacgggctgccggcc
tcggcggtggtgcgtgtgccgccgctcggcgcggtgtggttcacccccgtccaggagggc
tga

DBGET integrated database retrieval system