KEGG   Kytococcus sedentarius: Ksed_10870Help
Entry
Ksed_10870        CDS       T00974                                 

Definition
DNA-(apurinic or apyrimidinic site) lyase/Formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
kse  Kytococcus sedentarius
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:kse03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1110425..1111318
Genome map
AA seq 297 aa AA seqDB search
MPELPEVEVVRAGLESHVVGRTIEVADVRGDRVARRHEGGAAALARALTGRRLCSAERRG
KFLWLPLDDGHALMTHLGMSGQMLVLPAEEPPVRHEHARLDFEDEGPTLRFADQRTFGGW
SVDPLVPDPHGGDHPGGVPATATHIAPDPFETCFDAGAVAARLRTRRGPVKRAILDQGLV
SGVGNIYADEALWRTGVHGERPGHSLTGPRARALLTHLQAVMGEALEQGGTSFDALYVNV
NGASGYFDRRLAVYGQQGRPCPACGSTVLRSPFDGRSSHWCPTCQTRPRSAPRGVAR
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgagctgcccgaggtggaggtggtccgcgcgggcctcgagtcccacgtggtgggg
cgcaccatcgaggtggccgacgtgcgcggtgaccgggtggcccgtcgccacgagggcggg
gcggcggccctggcccgggcgctgaccgggcgccgtctgtgctcggccgagcgccgcggc
aagttcctctggttgccgctcgacgacggccacgccctcatgacccacctgggcatgagc
gggcagatgctggtactccccgccgaggagccgccggtgcgccacgagcacgcccggctg
gacttcgaggacgagggccccaccctgcgcttcgccgaccagcgcaccttcggcgggtgg
tcggtggaccctctggtgcccgacccccacggaggcgaccaccccgggggcgtcccggcg
accgccacccacatcgcgcccgaccccttcgagacctgcttcgatgccggcgcggtcgcc
gcccgcctgcgcacccggcggggcccggtcaagcgcgccatcctcgaccagggcctggtc
agcggcgtgggcaacatctacgccgacgaggcgctgtggcgcaccggggtccacggggag
cgcccggggcactccctgaccggcccccgcgcccgggccctgttgacgcacctgcaggcg
gtcatgggcgaggccctggagcagggcggcacgagcttcgacgcgctgtacgtcaacgtc
aacggggccagcggctacttcgaccgacggctggcggtctacggccagcagggccggccc
tgcccggcctgcggcagcacggtgctgcggtcgcccttcgacggccgcagctcccactgg
tgccccacctgtcagacccgtccccggtcggcgccgcggggggtcgcgcgatga

DBGET integrated database retrieval system