KEGG   Kytococcus sedentarius: Ksed_11300Help
Entry
Ksed_11300        CDS       T00974                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
kse  Kytococcus sedentarius
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:kse00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Ksed_11300
Enzymes [BR:kse01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Ksed_11300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1155962..1157152
Genome map
AA seq 396 aa AA seqDB search
MSARRVTLLGSTGSIGTQAVEVIQKHPDRFVVHGLAAGGSDLGLFARQVVALRPEAVALA
RGSQDELRAALDAVPGGADARPRILTGPEAAAELAADPVDVVLNGITGSIGLRPTLAALA
AGSTLALANKESLIVGGPLVKAALQRPDQIVPVDSEHAAIAQCLPSGRREEVRRLVITAS
GGPFRGRSRAELAAVTPEQALAHPNFAMGRVVTTNSATLVNKGLEVIEAHLLFDVPFDDI
QVVVHPQQQIHSMVEFRDGSTIAQIGPPRMLVPIALGLSWPERLAEVDEPTDWTRAQSWQ
FEPLDAVAFPAVDLAVHVGRLGGTAPAVYNAANEECVDAFHDGRIAFTDITDTVAAVVEQ
LGSGGEDGSLRLEDVLSAEDEARAAAHRLIEAAGCR
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcacgtcgcgtcaccctgctgggatccaccggttcgatcggcacccaggcggtg
gaggtcatccagaagcaccccgaccgcttcgtcgtgcacggtctcgccgccggcggcagt
gacctggggctgttcgcccggcaggtggtcgccctgcggcccgaggcggtcgcgctggcc
cgcggcagccaggacgaattgcgcgcggccctggacgccgtgcccggcggcgcggacgca
cgcccccgcatcctgaccggccccgaggcggccgccgagctcgcggccgacccggtcgac
gtggtgctcaacggcatcaccggctccatcggcctgcggcccacgctggccgccctggcg
gcgggcagcaccctggcgctggccaacaaggagtcgttgatcgtcgggggcccgctggtg
aaggcagccctccagcgtcccgaccagatcgtgccggtggactccgagcacgccgccatc
gcccagtgcctgcccagcggccgccgggaggaggtccgccggctggtgatcacggcctcc
gggggccccttccgcggccgcagccgcgccgagctcgccgcggtgacgcccgagcaggcc
ctggcccacccgaacttcgcgatggggcgcgtggtcaccacgaactcggccaccctggtc
aacaaggggctggaggtcatcgaggcccacctgttgttcgacgtgcccttcgacgacatc
caggtggtggtccacccacagcagcagatccactcgatggtcgagttccgcgacggctcc
accatcgcccagatcggaccgccccggatgctggtgcccatcgccctgggtctgtcctgg
cccgagcgcctggccgaggtcgacgagcccaccgactggacccgcgcgcagtcctggcag
ttcgagcccctcgatgcggtggccttcccggcggtcgacctcgcggtccacgtggggcgg
ctgggcggcaccgccccggcggtctacaacgcggccaacgaggagtgcgtcgacgccttc
cacgacggccgcatcgccttcaccgacatcaccgacaccgtggccgccgtggtcgagcag
ctcgggagcgggggagaggacggctccctgcgtctggaggacgtgctgagcgccgaggac
gaggcacgggcggccgcacaccgcctcatcgaggctgcgggatgccgctga

DBGET integrated database retrieval system