KEGG   Kytococcus sedentarius: Ksed_12660Help
Entry
Ksed_12660        CDS       T00974                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
kse  Kytococcus sedentarius
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:kse00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:kse00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1305044..1306003
Genome map
AA seq 319 aa AA seqDB search
MKHLLSIADLDRESLLRLLDAAEGHLALQDERVKKRDHLRGRTVINLFFEDSTRTRSSFE
IAGKWLGADTINIAAKGSSVSKGESLRDTVATIAAMGVDALVVRHPASGAPAQIARWLDA
QGRRASVVNAGDGTHEHPTQALLDAFTLRRALGELEGRHVAIVGDVTHSRVARSNLIALR
TLGARVTVVAPATLMPSGAAAWAARDGFALSHELDAVLPTVDAAMMLRVQSERMAGGYFP
TPREYTVVNGLTRDRLAALPEHAVICHPGPMNRGLEISPEAADDARSRVLDQVSAGVAVR
MAVLDTLMNDPHHTDGVQA
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaagcacctgctcagcatcgccgacctggaccgggagtccctcctgcggctcctcgat
gcggccgaggggcacctcgcgctgcaggacgagcgggtgaagaagcgggaccacctgcgc
ggccgcaccgtcatcaaccttttcttcgaggactccacccgcacccggtcgtccttcgag
atcgccggcaagtggctcggggccgacacgatcaacatcgccgccaagggctcgtcggtg
agcaagggggagtcgctgcgcgacaccgtggccaccatcgccgcgatgggggtggacgcg
ctcgtggtgcgtcaccccgcatcgggggcaccggcgcagatcgcccgctggctcgacgcc
cagggccgccgcgcctcggtggtgaacgccggtgacggcacccacgagcaccccacccag
gcgctcctggacgcgttcaccctgcgccgggccctgggggagctggaggggcggcacgtc
gcgatcgtcggggacgtcacccactcccgggtggcgcggtccaacctcatcgcgctgcgc
accctgggggcgcgggtgacggtggtcgcgccggcgacgctcatgcccagcggggcggcg
gcctgggccgcacgggacggcttcgcgctctcgcacgaactcgacgcggtgctccccacg
gtcgacgccgccatgatgctgcgcgtgcagtccgagcgcatggccggcgggtacttcccg
accccgcgtgagtacacggtggtcaacggcctgacccgggaccggttggccgccctgccg
gaacacgccgtgatctgccaccccgggcccatgaaccgcggcctggagatcagccccgag
gccgccgacgacgcccggtcgcgggtgctcgaccaggtgagcgccggggtggccgtgcgc
atggccgtgctggacaccctcatgaacgacccccaccacacggacggagtgcaggcatga

DBGET integrated database retrieval system