KEGG   Kytococcus sedentarius: Ksed_12660Help
Entry
Ksed_12660        CDS       T00974                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
kse  Kytococcus sedentarius
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kse00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Ksed_12660
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Ksed_12660
Enzymes [BR:kse01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Ksed_12660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1305044..1306003
Genome map
AA seq 319 aa AA seqDB search
MKHLLSIADLDRESLLRLLDAAEGHLALQDERVKKRDHLRGRTVINLFFEDSTRTRSSFE
IAGKWLGADTINIAAKGSSVSKGESLRDTVATIAAMGVDALVVRHPASGAPAQIARWLDA
QGRRASVVNAGDGTHEHPTQALLDAFTLRRALGELEGRHVAIVGDVTHSRVARSNLIALR
TLGARVTVVAPATLMPSGAAAWAARDGFALSHELDAVLPTVDAAMMLRVQSERMAGGYFP
TPREYTVVNGLTRDRLAALPEHAVICHPGPMNRGLEISPEAADDARSRVLDQVSAGVAVR
MAVLDTLMNDPHHTDGVQA
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaagcacctgctcagcatcgccgacctggaccgggagtccctcctgcggctcctcgat
gcggccgaggggcacctcgcgctgcaggacgagcgggtgaagaagcgggaccacctgcgc
ggccgcaccgtcatcaaccttttcttcgaggactccacccgcacccggtcgtccttcgag
atcgccggcaagtggctcggggccgacacgatcaacatcgccgccaagggctcgtcggtg
agcaagggggagtcgctgcgcgacaccgtggccaccatcgccgcgatgggggtggacgcg
ctcgtggtgcgtcaccccgcatcgggggcaccggcgcagatcgcccgctggctcgacgcc
cagggccgccgcgcctcggtggtgaacgccggtgacggcacccacgagcaccccacccag
gcgctcctggacgcgttcaccctgcgccgggccctgggggagctggaggggcggcacgtc
gcgatcgtcggggacgtcacccactcccgggtggcgcggtccaacctcatcgcgctgcgc
accctgggggcgcgggtgacggtggtcgcgccggcgacgctcatgcccagcggggcggcg
gcctgggccgcacgggacggcttcgcgctctcgcacgaactcgacgcggtgctccccacg
gtcgacgccgccatgatgctgcgcgtgcagtccgagcgcatggccggcgggtacttcccg
accccgcgtgagtacacggtggtcaacggcctgacccgggaccggttggccgccctgccg
gaacacgccgtgatctgccaccccgggcccatgaaccgcggcctggagatcagccccgag
gccgccgacgacgcccggtcgcgggtgctcgaccaggtgagcgccggggtggccgtgcgc
atggccgtgctggacaccctcatgaacgacccccaccacacggacggagtgcaggcatga

DBGET integrated database retrieval system