KEGG   Kytococcus sedentarius: Ksed_12880Help
Entry
Ksed_12880        CDS       T00974                                 

Definition
indole-3-glycerol phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
kse  Kytococcus sedentarius
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:kse00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Ksed_12880
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Ksed_12880
Enzymes [BR:kse01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Ksed_12880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1329883..1330704
Genome map
AA seq 273 aa AA seqDB search
MTPTVLDAILEGVREDVADRERAVPRAALAQVPVAAPRPVLGAFRAPGASLIAEIKRSSP
SKGVLAPIGEPADLARTYERAGATAVSVLTERRRFGGSLADLVAVRAAVDLPLLRKDFVV
GEYQVHEGRAAGADLVLLIVAALDDAQLSDLLALTHDLGMEALVEVHDEAELERAVTVAS
RIIGVNSRNLKTLEVDPGTPARLVPQVPADVVAVSESGIRTPQDVDTAVRAGARAVLVGE
ALVTAEDPGAAAAALVAAGAPSSHAPTTGGASA
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
gtgacccccacggtgctggacgcgatcctcgagggggtccgcgaggacgtcgccgaccgc
gagcgggcggtgccccgggccgccctggcgcaggtcccggtggccgcaccgcgcccggtg
ctgggcgccttccgcgctcccggcgcctccctcatcgcggagatcaagcgcagcagcccc
agcaagggggtgctggcccccatcggtgagccggccgacctcgcccgcacctacgagcgc
gccggcgccacggccgtctcggtgctcaccgagcgccgccggttcggggggtcgctggct
gacctggtggccgtgcgtgccgcggtggacctgcccctgctgcgcaaggacttcgtggtg
ggcgagtaccaggtgcacgagggacgggccgccggcgccgacctggtgctgctcatcgtc
gcggccctggacgacgcgcagctctccgacctgctcgccctcacccacgacctgggcatg
gaggccctggtcgaggtgcacgacgaggccgagctcgaacgcgcggtcaccgtggccagc
cgcatcatcggtgtcaacagccgcaacctgaagaccctcgaggtggaccccggcaccccg
gcccggctggtgccgcaggtgcctgccgacgtggtcgcggtcagcgagtccggcatccgc
accccccaggacgtcgacaccgccgtccgcgccggcgcccgcgccgtcctggtgggcgag
gcactcgtcacggcggaggaccccggcgccgctgcggcggccctcgtcgcggccggcgcc
ccctcatcgcacgcccccacgaccggaggtgcctcggcatga

  All links  
No link information was found.   
DBGET integrated database retrieval system