KEGG   Kytococcus sedentarius: Ksed_12890Help
Entry
Ksed_12890        CDS       T00974                                 

Definition
(GenBank) tryptophan synthase, beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
kse  Kytococcus sedentarius
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:kse00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Ksed_12890
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ksed_12890
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Ksed_12890
Enzymes [BR:kse01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Ksed_12890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1330701..1331957
Genome map
AA seq 418 aa AA seqDB search
MTDLFTPQFGEFGGAYVPEALTAALVELDAELTRALVDPEFTDRLNGLHATYTGRPSPLT
DARRLSEHAGGARILLKREDLNHTGSHKINNVLGQVLLAERMGKRRVIAETGAGQHGVAT
ATAAALMGMECTVYMGAVDTRRQALNVARMQLLGAEVVAVEHGSATLKDAINEAMRDWVA
SVEDTHYVLGTVTGPHPFPTMVRRFHEVIGTEAREQVLAVAGRLPDVAVACVGGGSNAIG
LFSGFLDDPSVELVGCEAGGEGIESGRHAARFAAGRPGVLHGAATYVLQDEGGQTLETHS
VSAGLDYPSVGPEHSHLHATGRARYVPVTDDEAMDAFRVLCRTEGIIPAIESAHAVAGAI
TEARRLGPDGLVLVNLSGRGDKDVDTAARWFGLVDDQGEAQPAADEDADDSTAQGVES
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgacggacctgttcaccccccagttcggcgagttcggcggcgcctacgtgcccgaggcg
ctcacggccgcgctcgtggagctcgacgccgagctcacccgggccttggtcgaccccgag
ttcaccgaccgcctcaacggcctgcacgccacctacaccggacgtcccagcccgctgacc
gacgcccgccggctctcggagcacgccgggggtgcccgcatcctgctcaagcgcgaggac
ctgaaccacaccggatcgcacaagatcaacaacgtcctgggccaggtgctgctcgccgag
cggatgggcaagcgccgtgtgatcgccgagaccggcgccggccagcacggggtggccacc
gccaccgccgcggcgctgatgggcatggagtgcacggtctacatgggggccgtggacacc
cgccggcaggccctcaacgtcgcgcgtatgcagctgctgggtgcggaggtggtggccgtc
gagcacggctcggccaccctcaaggacgcgatcaatgaggccatgcgcgactgggtggcc
agtgtcgaggacacccactacgtcctgggcaccgtcaccggaccccaccccttcccgacg
atggtgcggcgcttccacgaggtgatcggcaccgaggcccgcgagcaggtgctggccgtc
gccggccggctgcccgacgtggccgtcgcgtgtgtgggcggagggtccaacgccatcggc
ctgttctccggcttcctcgacgacccctcggtggagctcgtcggctgcgaggccggggga
gagggcatcgagtccggccgccacgcggcccgcttcgccgccgggcgccccggggtgctg
cacggcgccgcgacctacgtgctgcaggacgagggcggccagacgctcgagacgcactcg
gtcagcgctgggctggactaccccagcgtgggtccggagcacagccacctccacgccacg
gggcgggcccggtacgtgcccgtgaccgatgacgaggcgatggacgccttccgggtgctc
tgccgcaccgaggggatcatccccgccatcgagtccgcgcacgccgtcgccggggcgatc
accgaggcccgccggctcgggcccgacggcctggtgctggtgaacctgtccggccgcggc
gacaaggacgtcgacaccgcagcccggtggttcgggctggtggacgaccagggcgaggcg
cagcccgccgccgacgaggacgccgacgacagcaccgcccagggagtcgagtcatga

DBGET integrated database retrieval system