KEGG   Kytococcus sedentarius: Ksed_12900Help
Entry
Ksed_12900        CDS       T00974                                 

Definition
(GenBank) tryptophan synthase, alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
kse  Kytococcus sedentarius
Pathway
kse00260  Glycine, serine and threonine metabolism
kse00400  Phenylalanine, tyrosine and tryptophan biosynthesis
kse01100  Metabolic pathways
kse01110  Biosynthesis of secondary metabolites
kse01130  Biosynthesis of antibiotics
kse01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:kse00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ksed_12900
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Ksed_12900
Enzymes [BR:kse01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Ksed_12900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB BtpA NeuB
Motif
Other DBs
NCBI-ProteinID: ACV06322
UniProt: C7NHG5
Position
1331954..1332832
Genome map
AA seq 292 aa AA seqDB search
MSNALESRFAQVADEGRSALVVYLPVGFPDVRTSCAAMVAAVEAGADVIEIGIPYTDPVM
DGPVIQNAADRALEHGAGVPDALECARAVAAAGGVPVVMSYWNPLLAHGVEALAAELAEA
GAAGVILPDLPPEAAGAWHRAADAHDLSTVHLVAPSTTPERVARITAASSGFVYAASTMG
VTGARASVSDVAAEVVARVRATTDLPVALGLGVSSGEQARQVTAFADGVIVGSALVTALA
RDCGVDLGAAPAADPAAPESVAPSAPSGPSGSAANFPRMTALVQEIAGALDD
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacgcactggagtcccgcttcgcgcaggtggccgatgaggggcgctccgccctg
gtggtctacctccccgtcggcttcccggacgtccgcacctcctgcgcggccatggtggcc
gccgtggaggccggcgcggacgtcatcgagatcggcatcccgtacaccgacccggtcatg
gacggcccggtcatccagaacgccgccgaccgggccctcgagcacggtgccggggtcccc
gacgcgctggagtgcgcgcgcgccgtggcggccgccggtggcgtgccggtggtgatgagc
tactggaacccgctgctggcccacggggtcgaggcgctggccgccgagctcgccgaggcg
ggcgcggccggcgtgatcctgccggacctgcccccggaggcagccggggcgtggcaccgc
gcggcggacgcgcacgacctctcgaccgtgcacctggtcgccccgagcacgacgccggag
cgagtcgcccgcatcaccgcggcctccagcgggttcgtgtacgccgccagcacgatgggg
gtgaccggcgcccgggcctcggtctcggacgtcgccgccgaggtggtggcccgggtgcgc
gcgaccaccgacctccccgtcgccctggggctgggcgtgtcctccggcgagcaggcccgc
caggtgacagccttcgccgacggggtgatcgtcggctcggccctcgtcaccgcgctcgcc
cgtgactgtggggtggacctcggcgccgcaccggccgccgacccggccgcgcccgagtcc
gtggcaccatctgctcccagcggaccctcaggttctgcggctaacttcccgcgcatgacg
gcactggtgcaggagatcgccggcgccctcgacgactga

DBGET integrated database retrieval system